KEGG   Glycine max (soybean): 100820069Help
Entry
100820069         CDS       T01710                                 

Definition
(R)-mandelonitrile lyase-like
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
gmx  Glycine max (soybean)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    100820069
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     100820069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 542 aa AA seqDB search
MERAISIVQLECVTLLILSSTLFSCATQEQGASSYLNMVVNASELPSEDYYDYIVVGGGT
AGCPLAATLSQSFRVLLLERGGVGHGDPNLMNQEGFLANLLNTESGDSPAQAFISEEGVP
NARGRVLGGSSAINAGFYSRADADFFARSGLPWNLTLVNDSYQWVEKEVVFRPNLKTWQS
AVRDGLLEAGVTPYNGFTLDHAKGTKIGGSTFDGAGRRHTSADLLRYARASNIKVGVYAS
VERLLLAASSAIGVLYRDQEGDYHHAFLREQGEVILSAGAIGSPQLLLLSGIGPRPYLSS
WGIPVAHHLPYVGHFLYDNPRNGITILPSLPLEHSLIQVVGITESGAYIEAASNVVPFTS
PPHTALVLRSPLYLTVATIISKISGPVSSGFLRLASTEVKENPVVRFNYLNNQVDVERCV
NGTRKIAEILRSRALRDFKFSNWFGERDFRFIGPALPLHQSDFPSMADYCRRTVSTIWHY
HGGCVVGRVVDPNLNLIGISSLRIVDGSVFSVSPGTNPQATLMMLGRYFGLKIIAERDAN
NN
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggagagagccataagcattgtgcagttagagtgtgtgacgttgttgatattgtccagc
acattgttttcgtgcgctactcaagagcaaggggcgagtagttatctgaatatggtggtg
aacgccagcgagttaccgtcggaagactactacgactacatcgtcgtgggtggcggcact
gccggatgcccactggcggcgacactctcgcagtcctttcgggtgcttttgctcgaacgc
ggaggcgttggtcacggcgaccccaacttgatgaaccaagaaggcttcttggccaacctc
ttgaacaccgaaagcggagactcacccgcccaagctttcatttccgaagagggagtcccc
aacgctcgtggccgcgttcttggtggcagcagcgccatcaacgccggcttctacagccga
gccgacgctgatttcttcgccaggtccggcttgccctggaacctcaccctggtcaacgac
tcataccaatgggtggagaaggaagtcgtcttcagacccaatctcaagacgtggcaatcc
gcggttcgcgatgggttgcttgaagcaggggttactccctacaacggtttcactctggac
cacgccaagggaaccaagatcggcggttccaccttcgacggcgccggcaggagacacacc
tctgcggatcttttgagatatgcacgcgcttccaacatcaaggtgggcgtctacgccagc
gtggagaggctgcttctggccgctagcagcgcaatcggagtcctctacagagaccaagaa
ggggattaccaccacgcattcttgcgggaacagggagaggtgattctctccgccggcgcc
atcggaagccctcagcttcttcttctgagcgggattggtccaaggccatatctgtcttcg
tgggggattcccgtggcgcatcacctaccctacgtgggacacttcctctacgataacccc
aggaacggaattacgattctgccctcgctcccactcgagcattctctgatccaagtggtg
gggattaccgagtccggcgcttacatagaggcggcgtccaacgtggttcctttcacgtcc
cctccgcacacagccttggtcctccggtccccgctctacctaacggtggcgacaataatt
tcaaagatttcggggccagtatccagtgggtttctgaggctggcttcgacggaggtgaag
gagaatcccgtggtgagattcaattacttgaacaaccaggttgacgtggagaggtgcgtg
aacgggacgaggaagatagcggagatactgaggagcagggctttgagggatttcaagttc
agcaactggttcggggagagagacttcaggttcattggcccggctttgccacttcaccag
agcgacttccctagcatggcggattactgccggcggacagtgagcaccatatggcactac
catggaggctgcgtggttggcagggtggttgatccaaatctcaacctcattggaatttct
tcccttcgtattgtggatggatccgtcttcagcgtatcgcccggaaccaatcctcaggcc
accctaatgatgctaggaaggtattttggactcaagataatcgcggaaagggacgcaaac
aacaactga

DBGET integrated database retrieval system