KEGG   Glycine max (soybean): 100820177Help
Entry
100820177         CDS       T01710                                 

Definition
probable histone H2B.1-like
Orthology
K11252  
histone H2B
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 143 aa AA seqDB search
MAPKAEKKPAEEKKSTVGDKAPAEKKPKAGKKLPKEGGAGGEGKKKKRNKKSVETYKIYI
FKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLV
LPGELAKHAVSEGTKAVTKFTSS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaggcggagaagaagcccgcagaggagaagaagtccacggtgggagacaag
gctccggcggagaagaagccaaaggccggaaagaagcttccgaaggagggaggcgccggc
ggagaagggaagaagaagaagaggaacaagaagagcgtggagacatacaagatctacatc
ttcaaggttctgaagcaggttcaccctgacattggtatctcaagcaaggccatgggaatc
atgaacagcttcatcaacgacatcttcgagaagcttgcccaggaatcttctagacttgcc
cgctacaacaagaaacccaccatcacttcgagggaaattcagaccgcggtcaggcttgtg
ctgcccggtgaattggctaagcacgccgtctctgagggtaccaaggccgtcaccaagttt
actagctcttaa

DBGET integrated database retrieval system