KEGG   Glycine max (soybean): 100820253Help
Entry
100820253         CDS       T01710                                 

Definition
phosphoinositide phospholipase C 6-like
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 365 aa AA seqDB search
MGAPLSHYLIYTGHNSYLTGNQLSSDCSEGPIIKALKRGVRVIELDLWPTYNKHDIKVDH
GWTLTNPASVIKCLESIKEYGFVASQYPVIITIEDHLTTDLRAKFAEMATQIFGEMLFYP
GTDCSCLTEFPSPESLKNRVIISTKPPKERFKSNRIKDNPMLNESDSSEEETWGNESPDS
NKNEVETEDTQNGSDRDEGNVSACECDHKPYQECSPDYKHIITIHNTKLKGCMKDKLKTD
GEVRRLSWSEKTLEKASESHGTDILRFTQKNILRVYPSAMRVKSSNFKPHIGWMYGAQMV
ACNMQGLGKSLWLMQGMFRANGGCGYVKKPQFLMEKHQCDNEFDPTRIQSVKKKTLKVSM
YHSII
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctccattgtcacattatctcatatatacaggccataactcctatttgacgggg
aatcagctcagcagtgactgcagtgaaggaccgatcataaaggctttgaaaagaggcgtg
cgtgttattgaacttgatttatggccaacatacaataagcatgatattaaagtagatcat
ggatggactctcacaaaccctgcttcagttatcaaatgtctagagtccataaaggaatat
ggttttgttgcatctcaatacccggtgatcataactatagaagaccatcttacaacagat
cttcgagctaaatttgcagaaatggcaactcaaatatttggggaaatgcttttttaccct
gggacagattgctcttgcttaacagaattcccttccccggaatcactaaaaaatcgagtt
attatatcaacgaaacctccgaaagaacgttttaagtccaaccgtatcaaggacaatcct
atgcttaatgaaagtgattcatctgaagaagaaacatggggaaatgaatctccagactct
aacaagaacgaagtggagactgaggacacccagaatggaagcgatcgtgatgagggaaat
gtaagtgcatgtgaatgtgaccataaaccatatcaggagtgttcacctgattacaaacac
ataattactatccataatacgaagctcaagggatgcatgaaggataaattgaaaacagac
ggtgaagttagacgcctaagttggagtgagaagacccttgaaaaggcttcagaatctcat
ggaacagatattcttaggttcacacagaaaaatatcctcagggtttacccaagtgcaatg
cgtgtcaaatcctcaaatttcaagccacatattgggtggatgtacggggctcaaatggtt
gcatgcaatatgcaggggcttggcaaatcgctctggttgatgcagggtatgttcagggca
aatggaggctgtggttatgtaaagaagcctcaatttctaatggagaagcatcaatgtgac
aatgagtttgatcctacaaggatacagtcagtgaagaagaagacattaaaggttagcatg
tatcattcaataatataa

DBGET integrated database retrieval system