KEGG   Glycine max (soybean): 100820495Help
Entry
100820495         CDS       T01710                                 

Definition
6-phosphofructokinase 4, chloroplastic-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100820495
   01230 Biosynthesis of amino acids
    100820495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100820495
   00030 Pentose phosphate pathway
    100820495
   00051 Fructose and mannose metabolism
    100820495
   00052 Galactose metabolism
    100820495
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100820495
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100820495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 541 aa AA seqDB search
MDISVSFSKTRPPPFSPSLCRQLSLRPNAPQLLRFSRNNGTFRRKPPPTISRPNKLAVTA
IQISNLSENEDDFVLEDVPHLTDFLPNLPSYPNPLQKSQGYSIVKKTFVSPEDVVAENVV
IQKGSPRGVHFRRTGPREKVYFKPEEVRACIVTCGGLCPGINTVIREIVCGLNNMYNVED
ILGIEGGYKGFYSKNTMMLTPKVVNHIHKCGGTFLRTSRGGHDTHKIVDNIEDRGINQVY
IIGGDGTHKGAALIYEEVKKRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINA
AHVEVESVENGVGIVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGRGGLFEFIEQ
RLKENGHLVIVVAEGAGQEYIAAEVHAADKKDASGNKLLLDIGPWLSDKIKDHFSMSRKM
AVNMKYIDPTYMIRAIPSNASDNIYCTLLAHGAVHGAMAGYTGFTVGPVNSKHAYIPIAR
VTEKQNKVKLTDRMWARLLASTNQPSFVASDQERVEKEIXEYINNMNIASLSRFKCLMGI
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatatctccgtttctttctccaaaacccgtcctcctccgttctctccctctctctgc
cgccaactttccctccgtccaaacgctccgcaactgctgcgattctcccgaaacaacgga
acctttcgccggaagcctccgccgacgatttctcgcccaaacaagctcgctgtcacagcc
attcagatttcaaacctatccgagaatgaagacgattttgtcctcgaagacgttccacac
ctcaccgactttcttcccaatttgccgtcatatccaaacccattgcaaaagagccaaggc
tactcaattgtcaagaaaacttttgtgagccccgaagatgtggttgctgaaaatgttgtt
attcaaaagggaagtcctagaggagttcattttcggcgtacaggacctcgagaaaaggtt
tatttcaagccagaagaagtacgtgcttgcatagtgacttgtggaggattatgcccagga
attaatacagtgattagggaaattgtatgtggcttgaacaacatgtataatgttgaagat
atacttgggattgagggaggatataaagggttttattcaaaaaataccatgatgttgact
cctaaagtggttaaccatatccataaatgtggtggaacctttcttcgtacatctcgtgga
ggacatgatacccacaagatagtagataacattgaggaccggggaataaatcaggtatac
attattggaggtgatggtactcacaaaggagctgcgctcatttatgaggaagttaaaaag
cgtggtcttcaagtggctgtggctgggattccaaagacaattgataatgatattgctgtg
atagacaaatcttttggatttgatactgctgtggaagaagcccagagagccattaacgct
gcacatgtggaggttgaaagtgttgaaaatggagttggaattgtcaagctgatgggcaga
tacagtggtttcattgcaatgtatgcaacattggcaagtcgagatgtggattgctgcttg
attccagagtctcccttttatttggaaggaagaggtgggctttttgagtttattgaacag
aggttaaaagaaaatgggcatttagttattgtggtagcagaaggagcaggtcaggaatat
attgctgcagaagtgcatgcagcagataaaaaggatgcatcagggaacaagctacttctt
gatattggtccatggttatctgataagatcaaggatcatttctcaatgtctcgaaagatg
gcagtgaatatgaaatatatagatccaacatacatgattcgggctattccaagtaatgcc
tcggacaacatttactgcactcttcttgcacatggtgctgttcatggagctatggctgga
tatactggcttcacagtcgggcctgtgaacagtaaacatgcttatatcccaattgcccgt
gtgacggagaaacaaaataaggtcaagctgactgataggatgtgggctagacttcttgca
tcgacgaatcaaccaagtttcgttgcctctgatcaagaaagagttgagaaagagatanat
gaatatataaataacatgaatattgcctctctatctaggtttaaatgtttaatgggtatt
gattga

DBGET integrated database retrieval system