KEGG   Glycine max (soybean): 100820495Help
Entry
100820495         CDS       T01710                                 

Definition
6-phosphofructokinase 4, chloroplastic-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:gmx01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gmx01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gmx00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:gmx00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gmx00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gmx00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 541 aa AA seqDB search
MDISVSFSKTRPPPFSPSLCRQLSLRPNAPQLLRFSRNNGTFRRKPPPTISRPNKLAVTA
IQISNLSENEDDFVLEDVPHLTDFLPNLPSYPNPLQKSQGYSIVKKTFVSPEDVVAENVV
IQKGSPRGVHFRRTGPREKVYFKPEEVRACIVTCGGLCPGINTVIREIVCGLNNMYNVED
ILGIEGGYKGFYSKNTMMLTPKVVNHIHKCGGTFLRTSRGGHDTHKIVDNIEDRGINQVY
IIGGDGTHKGAALIYEEVKKRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINA
AHVEVESVENGVGIVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGRGGLFEFIEQ
RLKENGHLVIVVAEGAGQEYIAAEVHAADKKDASGNKLLLDIGPWLSDKIKDHFSMSRKM
AVNMKYIDPTYMIRAIPSNASDNIYCTLLAHGAVHGAMAGYTGFTVGPVNSKHAYIPIAR
VTEKQNKVKLTDRMWARLLASTNQPSFVASDQERVEKEIXEYINNMNIASLSRFKCLMGI
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatatctccgtttctttctccaaaacccgtcctcctccgttctctccctctctctgc
cgccaactttccctccgtccaaacgctccgcaactgctgcgattctcccgaaacaacgga
acctttcgccggaagcctccgccgacgatttctcgcccaaacaagctcgctgtcacagcc
attcagatttcaaacctatccgagaatgaagacgattttgtcctcgaagacgttccacac
ctcaccgactttcttcccaatttgccgtcatatccaaacccattgcaaaagagccaaggc
tactcaattgtcaagaaaacttttgtgagccccgaagatgtggttgctgaaaatgttgtt
attcaaaagggaagtcctagaggagttcattttcggcgtacaggacctcgagaaaaggtt
tatttcaagccagaagaagtacgtgcttgcatagtgacttgtggaggattatgcccagga
attaatacagtgattagggaaattgtatgtggcttgaacaacatgtataatgttgaagat
atacttgggattgagggaggatataaagggttttattcaaaaaataccatgatgttgact
cctaaagtggttaaccatatccataaatgtggtggaacctttcttcgtacatctcgtgga
ggacatgatacccacaagatagtagataacattgaggaccggggaataaatcaggtatac
attattggaggtgatggtactcacaaaggagctgcgctcatttatgaggaagttaaaaag
cgtggtcttcaagtggctgtggctgggattccaaagacaattgataatgatattgctgtg
atagacaaatcttttggatttgatactgctgtggaagaagcccagagagccattaacgct
gcacatgtggaggttgaaagtgttgaaaatggagttggaattgtcaagctgatgggcaga
tacagtggtttcattgcaatgtatgcaacattggcaagtcgagatgtggattgctgcttg
attccagagtctcccttttatttggaaggaagaggtgggctttttgagtttattgaacag
aggttaaaagaaaatgggcatttagttattgtggtagcagaaggagcaggtcaggaatat
attgctgcagaagtgcatgcagcagataaaaaggatgcatcagggaacaagctacttctt
gatattggtccatggttatctgataagatcaaggatcatttctcaatgtctcgaaagatg
gcagtgaatatgaaatatatagatccaacatacatgattcgggctattccaagtaatgcc
tcggacaacatttactgcactcttcttgcacatggtgctgttcatggagctatggctgga
tatactggcttcacagtcgggcctgtgaacagtaaacatgcttatatcccaattgcccgt
gtgacggagaaacaaaataaggtcaagctgactgataggatgtgggctagacttcttgca
tcgacgaatcaaccaagtttcgttgcctctgatcaagaaagagttgagaaagagatanat
gaatatataaataacatgaatattgcctctctatctaggtttaaatgtttaatgggtatt
gattga

DBGET integrated database retrieval system