KEGG   Glycine max (soybean): 102660829Help
Entry
102660829         CDS       T01710                                 

Definition
steroid 5-alpha-reductase DET2-like
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
gmx  Glycine max (soybean)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    102660829
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102660829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 263 aa AA seqDB search
MIPEHYSDSSLFHRSLLTLFLIAPPTFLSLTFLQAPYGKHHRPGWGPNLPPPLAWLFMES
PTLWLTLLLFPLGLHSHNPKAQALITPFLIHYFNRTILYPLHLLLTPSKKTPTGFPLGVA
LMAFAFNVLNSYLQARTVSHYINHYDDSGFFWFRFLCGLLVFLLGMGINVWADRVLLRLK
SEGKGYVVPRGGLFELVACPNYFGEIVEWLGWAVMTWSWAGLGFFVYTFANLGPRARANR
RWYLEKFGEDYPKERKAVIPYLY
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatcccagaacactactccgactcatctctcttccaccgctccctccttaccctcttc
ctaatcgcaccccccaccttcctctccctcaccttcctccaggccccctacggcaagcac
cacaggcccggctgggggcccaacctccctccccccttagcctggctcttcatggaaagc
ccaaccctctggctcaccctcctcctcttcccactgggcctccactcccacaaccccaaa
gcccaagccctcatcacccccttcctaatccactacttcaaccgcaccatcctctaccct
ctccacctcctcctcactccttcaaagaaaaccccaacgggcttccccctcggcgtagcc
ctaatggccttcgccttcaacgttctcaattcctacctccaggcccgaacggtctctcac
tacatcaatcactatgatgactcgggttttttctggttccggtttttgtgtgggcttttg
gtgtttttattggggatggggattaatgtatgggctgatagggttttgttgcggctcaag
agcgaggggaagggctacgtggtgccgcgcggtgggttgttcgagctcgtggcgtgtccg
aattactttggggagattgtcgagtggctgggctgggccgtgatgacttggtcatgggcc
gggctgggcttttttgtttacacttttgctaatttgggtccaagggcccgggccaaccgg
aggtggtatttggagaagtttggggaggattatcccaaggagaggaaggctgttattcct
tacttgtattga

DBGET integrated database retrieval system