KEGG   Glycine max (soybean): 102669763Help
Entry
102669763         CDS       T01710                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 4-like
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gmx  Glycine max (soybean)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    102669763
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    102669763
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102669763
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     102669763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1055 aa AA seqDB search
MTDITDDIAEEISFQGFEDDCKLLGNLLNDILQREAGSTFVDKLEKIRVLSQSACNMRQA
GMEDLAEMLEKQLASELSKMTLEEALPLARAFSHHLTLMGIAETHHRVRKGGNMVLAAKS
CDDIFNNLLQDGVSPDELYNTVFKQEVEIVLTAHPTQINRRTLQYKHLKIAHLLDYNDRP
DLSPEDRDMLIEDLVREITSIWQTDELRRSKPTPVDEARAGLNIVEQSLWKAVPHYLRRV
SSALKKHTGKPLPLTCTPIKFGSWMGGDRDGNPNVTAKVTKDVSLLSRWMAIDLYIREVD
GLRFELSMNQCSDKLSELAHEILKEGNDEEDHHEHWNGSMSRSQSKHPNQQASPLPTKLP
AGAHLPSCARPEEGGSEYPRHVPGADHKQPNHKGGETSSSTESNGGSQNVRSSIPISPNS
SSSLVSMTRSPSFNSSQLVAQRKLFAESQIGRTSFKRLLEPKVPQVPGIAPYRVVLGYIK
DKLQRTRRRLELLIEDGPSEHDPMDYYETTDQLLEPLLLCYESLQLCGSGVLADGRLADL
IRRVATFGMVLMKLDLRQESGRHAETIDAITRYLDMGTYSEWDEEKKLDFLTRELKGKRP
LVPPSIEVAPDVREVLDTFRTAAELGSDSFGAYVISMASNASDVLAVELLQKDARLAVSG
ELGRACPGGTLRVVPLFETVKDLRGAGSVIRKLLSIDWYRQHIIKNHNGHQEVMVGYSDS
GKDAGRFTAAWELYKAQEDVVAACNEYDIKVTLFHGRGGSIGRGGGPTYMAIQSQPPGSV
MGTLRSTEQGEMVQAKFGLPQTAVRQLEIYTTAVLLATLRPPQPPREEKWRNLMEDISKI
SCQCYRNVVYENPEFLSYFQEATPQSELGFLNIGSRPTRRKSSTGIGHLRAIPWVFAWTQ
TRFVLPAWLGVGAGLKDACEKGQTEELKAMYREWPFFQSTIDLIEMVLGKADIPIAKHYD
EVLVSQKRQELGKQLRNELISTGKFVLAVSGQEKPQQNNRSLRKLIESRLPFLNPMNMLQ
VEILKRLRCDDDNLKARDALLITINGIAAGMRNTG
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgacggacatcactgacgacatagcggaggaaatctccttccagggcttcgaagatgac
tgtaaattgctagggaaccttctcaacgacattctccagagggaggctggctccaccttc
gttgacaagctcgaaaaaattcgagtcctttcacagagtgcttgtaatatgagacaagcg
ggaatggaggacttggctgagatgctagagaagcaattggcttcagagttatccaagatg
acgctggaagaagctttgccccttgctcgtgcctttagccatcatcttactttgatgggt
atagctgaaacccaccatagggttcgtaaaggaggaaatatggttcttgctgcaaaatct
tgtgatgatatctttaacaacctgttgcaagatggggtttctccagatgagctttataac
acagtgttcaagcaggaggttgaaattgttctcactgctcatcccactcaaattaaccgt
cgtaccttgcaatacaaacaccttaaaattgctcatcttttggattataatgatcgacct
gatcttagccctgaagatcgagatatgttgattgaagatctggtgagagagataacttca
atatggcagacagatgaacttaggcgttcaaaacccacaccagtagatgaagctagggcg
ggattgaatattgtggagcagtcactctggaaagctgttcctcattatttacgtcgagtt
agcagcgctttaaagaagcacacaggaaaaccacttccattgacttgcactccaataaaa
tttggatcttggatgggaggtgatagagatggaaacccaaatgtgacagcaaaggtcaca
aaagatgtttcacttctgtcaagatggatggcgattgacctctacattcgggaagtggat
ggcctaagatttgagctatccatgaaccagtgcagtgataagttgtcagaactggcacat
gaaattctaaaagaaggtaatgatgaggaggatcaccatgagcactggaatggatctatg
agtagaagtcaatcaaaacatcctaatcaacaagcttcaccacttccaactaaacttcca
gctggagctcatttaccctcttgtgctcggcctgaagagggtggatctgagtatcccaga
cacgtgccaggagctgatcacaagcaacccaatcacaagggtggtgagacttcaagttca
actgagagcaatggtggcagtcaaaatgtccgttcgtcaataccaatttcaccaaattcc
agttcttcattagtttcaatgacacgctcgccttccttcaactctagtcaacttgttgct
cagaggaaactgtttgcagaatcccaaataggaaggaccagttttaagaggcttttggag
ccaaaggtccctcaggttcctggaattgctccttatagagttgtccttggatatataaaa
gataagcttcagagaactcgtagacggttggagcttcttatcgaggatggtccatctgaa
catgatcctatggattattatgaaacaacagatcagcttttagaacctcttctcctttgt
tatgaatctttgcaattatgtggatctggggtgctagctgatggtcgactagctgatctg
attcgaagagttgctacttttggcatggtgttaatgaagcttgacttgcgtcaggaatcc
ggcagacatgctgaaacaattgatgcaattacgaggtatttggatatgggtacgtacagt
gaatgggatgaagaaaagaaactggacttcttaactagagagttgaaagggaagagacca
ctggttcctcccagtatagaggttgctccagatgttagagaagtcttggatacgttccga
actgctgctgagctagggagtgattcatttggtgcctatgtgatctctatggcctcaaat
gctagtgatgtccttgcagtagagcttttgcagaaggatgcgcgacttgctgttagcggg
gagttaggaagagcatgtcctggtggaacgctgcgggtggttcctctatttgaaactgtg
aaggacctgagaggagctggttcagttatcagaaagcttttgtcaatagattggtaccgc
caacacatcattaaaaaccataatgggcatcaagaggttatggttggatattctgattct
ggtaaagatgccgggcgcttcactgctgcttgggaactttacaaagctcaggaggatgtt
gtggctgcatgcaatgagtatgatattaaggttactctcttccatggccgtggaggtagt
attggccgcggtggtggcccaacatatatggctattcagtctcaaccacccggctctgtc
atgggaacccttcgttcaactgagcaaggagagatggtgcaggccaagtttggcttgcca
cagacagctgtcagacagctagagatatacacaacagctgtgctacttgctacccttcgt
ccacctcaaccgccacgtgaagaaaaatggcgcaatcttatggaagacatttcaaagatc
agctgccaatgttaccgcaatgtagtgtatgaaaatccagagttcctgtcatacttccag
gaagccacacctcaatcagagcttggttttctcaacatcggcagccgccccacaaggcga
aagagctcaacaggaattggacacctccgtgccattccttgggtgtttgcatggactcaa
accaggtttgttcttccagcctggcttggagttggagcaggcttgaaagatgcttgtgag
aaaggacaaactgaagagctaaaggccatgtacagagagtggcctttctttcaaagcaca
atagacttgattgagatggttttgggaaaagcagatattcctattgctaagcactatgat
gaagttcttgtctcacaaaagagacaagaacttggaaagcaactgaggaatgaactcatc
tcaactggcaagtttgttctagcggttagtgggcaggagaaacctcaacagaataataga
agcttaaggaagctgattgagagtagacttccctttctgaaccccatgaatatgttgcaa
gtagagatactcaagaggctaagatgtgatgatgacaatcttaaagccagagatgccttg
cttatcaccataaatggtattgctgctgggatgaggaacactggttaa

DBGET integrated database retrieval system