KEGG   Glycine max (soybean): 547602Help
Entry
547602            CDS       T01710                                 

Gene name
CHI, CHI1, CHI1A
Definition
chalcone isomerase (EC:5.5.1.6)
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
gmx  Glycine max (soybean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    547602 (CHI)
Enzymes [BR:gmx01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     547602 (CHI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 218 aa AA seqDB search
MATISAVQVEFLEFPAVVTSPASGKTYFLGGAGERGLTIEGKFIKFTGIGVYLEDKAVPS
LAAKWKGKTSEELVHTLHFYRDIISGPFEKLIRGSKILPLAGAEYSKKVMENCVAHMKSV
GTYGDAEAAAIEKFAEAFKNVNFAPGASVFYRQSPDGILGLSFSEDATIPEKEAAVIENK
AVSAAVLETMIGEHAVSPDLKRSLASRLPAVLSHGIIV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgatcagcgcggttcaggtggagttcctggagtttccagcggtggttacttca
ccagcctccggcaagacctatttcctcggcggcgcaggggagagaggattgacgattgag
gggaagttcataaagttcacaggcataggagtatacttggaggataaggcggtgccatca
ctcgccgctaagtggaagggtaaaacttcagaggagttagttcacaccctccacttctac
agggatatcatttcagggccgtttgaaaagctaattagagggtcgaagattctgccattg
gctggcgctgaatactcaaagaaggtgatggaaaactgcgtggcacacatgaagtctgtt
gggacttacggtgatgctgaagccgcagccattgaaaagtttgctgaagccttcaagaat
gtgaattttgcacctggtgcctctgttttctacagacaatcacctgatggaatcttgggg
cttagtttctctgaagatgcaacaataccagaaaaggaggctgcagtgatagagaacaag
gctgtatcagcggcggtcttggagaccatgattggtgaacatgctgtttcccctgactta
aaacgcagtttggcttctcgattgcctgcggtattgagccacggcattatagtctga

DBGET integrated database retrieval system