KEGG   Glycine max (soybean): 547736Help
Entry
547736            CDS       T01710                                 

Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
gmx  Glycine max (soybean)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:gmx03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:gmx03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 335 aa AA seqDB search
MADFQTSTHRAKWIFSPQQLVEKYRAANQRAKQILEKCGATLMEVDVDGSLSYPEPQMTA
KDSAEKHSRTKPLTIEEEQCIKVFYENKLQEVCNNFRFPHKIQATALIYFKRFYLQWSVM
EHQPKHIMLTCIYAACKIEENHVSAEELGKGISQDHQMILNNEMIVYQSLEFDLIVYAPY
RSVEGFINDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALRNS
NAFHRVIDFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELKHINRKLKS
CWGHHSHDEGKKREKKSKHKSKKSSNEAQNMPSIA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctgattttcagacctctacccacagagccaagtggattttctctcctcaacagctg
gttgagaaatatagagctgccaatcagagagccaaacaaattctagagaagtgtggagca
acactaatggaagtagatgttgatggatcgttgtcatatcctgaaccccaaatgactgca
aaggatagtgctgaaaagcattctcgaacaaaacctcttactattgaagaagaacaatgt
ataaaggtattttatgaaaacaagctacaagaagtatgtaacaatttccgcttccctcat
aagatccaggcaacagcccttatctattttaaaagattctatctgcaatggtcagtgatg
gaacatcaaccaaaacacattatgttgacctgcatatatgctgcctgtaaaatagaagaa
aatcatgtgtcagctgaggagcttggtaaggggatatcacaggatcatcaaatgattctc
aataatgagatgatagtttatcagagtttggaatttgatcttattgtgtatgcaccatat
cgctcagttgaaggttttataaatgatatggaggaattctttaatgctggtgataaccag
cttgaaatgctcaagactttgcaagagacagcaagatttgaagttgataaaatgatgctt
acagatgcaccacttttatttcctcctgggcagttggccttggctgctttacgcaactca
aatgcattccacagagtcattgactttgatagttatcttaggggtattttttcccgtgag
aattccatgcatacaatgtccgagctttctgaatcactggatgcaattgattcttgggtt
agaaaatacaaaagtccttctgagaaggaattgaagcatatcaaccgaaaactgaagtct
tgttggggtcatcactctcatgacgagggcaagaagcgggagaagaaatcaaagcacaag
tccaaaaagagctcaaatgaagctcaaaatatgccatctattgcctag

DBGET integrated database retrieval system