KEGG   Glycine max (soybean): 547736Help
Entry
547736            CDS       T01710                                 

Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
gmx  Glycine max (soybean)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    547736
  Replication and repair
   03420 Nucleotide excision repair
    547736
Transcription machinery [BR:gmx03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     547736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 335 aa AA seqDB search
MADFQTSTHRAKWIFSPQQLVEKYRAANQRAKQILEKCGATLMEVDVDGSLSYPEPQMTA
KDSAEKHSRTKPLTIEEEQCIKVFYENKLQEVCNNFRFPHKIQATALIYFKRFYLQWSVM
EHQPKHIMLTCIYAACKIEENHVSAEELGKGISQDHQMILNNEMIVYQSLEFDLIVYAPY
RSVEGFINDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALRNS
NAFHRVIDFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELKHINRKLKS
CWGHHSHDEGKKREKKSKHKSKKSSNEAQNMPSIA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctgattttcagacctctacccacagagccaagtggattttctctcctcaacagctg
gttgagaaatatagagctgccaatcagagagccaaacaaattctagagaagtgtggagca
acactaatggaagtagatgttgatggatcgttgtcatatcctgaaccccaaatgactgca
aaggatagtgctgaaaagcattctcgaacaaaacctcttactattgaagaagaacaatgt
ataaaggtattttatgaaaacaagctacaagaagtatgtaacaatttccgcttccctcat
aagatccaggcaacagcccttatctattttaaaagattctatctgcaatggtcagtgatg
gaacatcaaccaaaacacattatgttgacctgcatatatgctgcctgtaaaatagaagaa
aatcatgtgtcagctgaggagcttggtaaggggatatcacaggatcatcaaatgattctc
aataatgagatgatagtttatcagagtttggaatttgatcttattgtgtatgcaccatat
cgctcagttgaaggttttataaatgatatggaggaattctttaatgctggtgataaccag
cttgaaatgctcaagactttgcaagagacagcaagatttgaagttgataaaatgatgctt
acagatgcaccacttttatttcctcctgggcagttggccttggctgctttacgcaactca
aatgcattccacagagtcattgactttgatagttatcttaggggtattttttcccgtgag
aattccatgcatacaatgtccgagctttctgaatcactggatgcaattgattcttgggtt
agaaaatacaaaagtccttctgagaaggaattgaagcatatcaaccgaaaactgaagtct
tgttggggtcatcactctcatgacgagggcaagaagcgggagaagaaatcaaagcacaag
tccaaaaagagctcaaatgaagctcaaaatatgccatctattgcctag

DBGET integrated database retrieval system