KEGG   Glycine max (soybean): 547750Help
Entry
547750            CDS       T01710                                 

Gene name
GK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gmx  Glycine max (soybean)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    547750 (GK)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    547750 (GK)
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     547750 (GK)
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   547750 (GK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 519 aa AA seqDB search
MANEDVFVGAIDQGTSSSRFIIYDAKTGVVGCHHVEFTQFYPQAGWVEHDPMEILESVKV
CVAKAVDKATADGFNVDKGLKAIGLTNQRETTLLWSKSTGLPLHNAIVWMDARTSSICRR
LEKELSGGRNHFVESCGLPISTYFSALKLLWLMENVDAVKEAIKKKDALFGTIDTWLIWN
LTGGVNGGLHVTDVSNASRTMLMNLKTLDWDASTLKTLNIPAEILPNIVSNAEIIGEVGS
GWPIAGVPIAGCLGDQHAAMLGQSCRKGEAKSTYGTGAFILLNTGEGIIQSKHGLLSTIA
FKLGPKAPTNYALEGSVAIAGAAVQWLRDGLGIISSAAEIEEMALQVESTGGVYFVPAFN
GLFAPWWREDARGVCIGITRFTSKGHIARAVLESMCFQVKDVLDSMHKDSGESESQKTEF
LLRVDGGATVNNLLMQIQADLVGCPVIRPADIETTALGAAYAAGLATGIWKEDFIFNTEE
KLKNARVFRPVMTEEVRKKKVDSWCKAVSKTFDLADLAI
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaagatgtgtttgttggcgcgatcgaccaaggaacgagcagcagcaggttc
ataatatacgacgcgaagactggagtagtaggatgccaccacgtggagttcacccagttc
tacccgcaagccgggtgggtggagcatgaccccatggagatcttggagagtgtgaaggtg
tgcgtggccaaggccgtcgataaggccaccgctgatggcttcaacgtcgataaaggcttg
aaggccattggtctcaccaatcagagagagaccactctcctctggagcaaatccaccggc
ctccctcttcacaacgccattgtttggatggatgctcgcacttcttccatttgcaggaga
ttggaaaaggagttatctggcggtagaaaccattttgtggagagttgtggcttgcctatt
agcacatacttcagtgctttgaagctgctgtggttgatggaaaatgtagatgccgtaaag
gaggccataaagaaaaaggatgcgctgtttggaactattgacacttggttgatatggaat
ctaactggtggggtgaatgggggattgcatgttaccgatgtttcaaatgcatctcgtaca
atgctcatgaatctaaaaacccttgactgggatgcatctaccttaaaaacccttaatatt
cctgctgaaattttgcctaatattgttagtaatgccgaaattataggagaggttgggtct
ggatggccaattgctggtgtccctattgctggatgtttaggggatcaacatgctgcaatg
ttaggacaatcatgccgtaaaggggaggctaagagcacttatggcacaggtgctttcata
ctactaaatactggtgaagggataattcaatcgaagcacggtcttttatccactatagct
ttcaagcttggcccaaaagctccaaccaattatgcattggaaggatcagttgctattgct
ggagctgcagtgcagtggcttagagacggtcttggcatcatttctagtgctgcagagata
gaggagatggcattacaggttgaatccactggtggggtttactttgttcctgcttttaat
ggattgtttgccccatggtggcgtgaggatgctcgcggggtttgtattggaataacaagg
tttacaagcaagggtcacattgcccgagctgtgcttgagagcatgtgtttccaagtgaaa
gatgtcttggattcaatgcataaagattcaggagaaagtgaatcccaaaaaacagagttt
ttgcttagagtggatggtggggcaactgtaaacaacctgctgatgcagattcaggcagat
ttggtgggatgtccagtaattagacctgctgacatagagacaacagcacttggagcagcc
tatgctgccggattagctactgggatttggaaagaagattttattttcaatactgaggag
aagttgaagaatgctagagttttccgtcctgtaatgactgaggaagtaaggaaaaagaaa
gttgactcttggtgcaaagctgttagtaaaactttcgacttagctgatcttgctatttaa

DBGET integrated database retrieval system