KEGG   Glycine max (soybean): 547845Help
Entry
547845            CDS       T01710                                 

Definition
alpha galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gmx  Glycine max (soybean)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    547845
  Lipid metabolism
   00561 Glycerolipid metabolism
    547845
   00600 Sphingolipid metabolism
    547845
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    547845
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     547845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 422 aa AA seqDB search
MIIQYSSNWSCNLSMMARLALCLLVMLSNNASSSSARLLFNRTRGGFTIMPKEVHRRNLL
DNGLGHTPPMGWNSWNHFACNIKEDLIRETADAMVSTGLAALGYQYINIDDCWGELNRDS
KGNLVPKASTFPSGMKALADYVHKNGLKLGIYSDAGNQTCSKTMPGSLGHEEQDAKTFAS
WGIDYLKYDNCENNNISPKERYPPMSEALANTGRPIFFSLCEWGSEDPATWAKSVGNSWR
TTGDIQDKWDSMISRADLNDKWASYAGPGGWNDPDMLEVGNGGMTTEEYRAHFSIWSLAK
APLLIGCDIRALDATTKELLSNKEVIAVNQDKLGVQGKKVKSTNDLEVWAGPLSNNKVAV
ILWNRSSSKAKVTASWSDIGLKPGTSVEARDLWAHSTQSSVSGEISAELDSHACKMYVVT
PN
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatcattcaatattcatcaaattggagctgcaatttatccatgatggcaaggcttgcc
ttgtgcctccttgtgatgttgagcaataatgcaagttcttcatctgctcgtttattgttc
aatagaacaagaggagggttcacgatcatgcctaaagaagtacataggagaaacctgctt
gataatggacttggccatacaccccccatgggatggaatagctggaaccattttgcctgc
aatattaaagaagacttaattcgagaaacagccgatgctatggtgtcaactggccttgct
gctctaggttaccaatatattaacatagatgattgttggggagagcttaaccgagactca
aagggcaatttggttcccaaagcctcaacatttccttccggaatgaaggctctagctgat
tatgttcataaaaatggtttgaagttggggatatattctgatgcaggaaatcaaacgtgc
agtaaaactatgcctggatcacttggacatgaagaacaagatgcaaaaacatttgcttcc
tgggggattgactacttgaagtatgataactgtgagaataacaatataagccccaaagaa
aggtaccctccaatgagtgaagctttggcaaacactggaaggccaattttcttctctttg
tgtgaatggggatcagaagatccagcaacttgggccaaaagtgtgggaaatagttggaga
acaacaggagacattcaagataagtgggatagtatgatatctcgtgcagatctaaatgac
aaatgggcttcttatgctggacctggaggatggaatgatcctgacatgctagaagttgga
aatggaggcatgacaacagaagaatatcgtgctcatttcagcatatggtcattagctaag
gctcctttgttgattggttgtgacattagagcactggatgccaccacaaaagaattgcta
agcaacaaagaagttattgcagttaatcaagacaagcttggagttcaaggaaagaaggtg
aaaagtactaatgatttagaggtttgggcaggtcctctcagtaataacaaggtagcagtg
atcttatggaatagaagttcatccaaagcaaaagttactgcatcctggtctgacataggc
ctgaaacctggaacttcagttgaagcaagagatttatgggcgcattcaacacaatcatct
gtttcgggagaaatatctgctgaattagattcacatgcttgtaagatgtatgtcgtcact
cctaactaa

DBGET integrated database retrieval system