KEGG   Glycine max (soybean): 547863Help
Entry
547863            CDS       T01710                                 

Definition
phosphoinositide-specific phospholipase C P12
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
gmx  Glycine max (soybean)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    547863
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    547863
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     547863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 553 aa AA seqDB search
MSADQLLRFLHDHQRETDCSAEDSNRILDSIIQSRKQNDTNAECDHHTDNNNNGLSLDEF
FRFLFLVDFNDPLKSQVHHDMNAPLSHYFIYTGHNSYLTGNQLSSDCSDVPIIKALQRGV
RVIELDLWPNSTKDDIDVVHGRTLTAPVSLIQCLKSIKEYAFVKSDYPVIITLEDHLTPF
LQAKVAEMIAQVFGDMLYFPQADSLTEFPTPESLKGRILISTKPPKEYLESKQFKDSDSE
RESTEEGSLSPCVIPELEAVDEKLNGSDLDEEGLNARDKKSDQQSAPEYKRLITIHAGKP
KGHVKHHLNNVGGVKRLSLSEQELEKASATYGSDIVRFTQKNIIRVYPKGTRVTSSNYRP
HIGWMYGAQMVAFNMQGHGKSLWYMQGMFRANGGCGYVKKPAFLIEKGPHNEVFDPKRAL
PVKKTLKVKVYMGNGWSSDFSKTHFDSFSPPDFYTKVCIVGVPADKANKKTKVIQDNWFP
VWDEEFEFPLTVPELALLRIEVREYDKHEKDDFGGQTCLPISELRSGFRAVPLFDQKGEQ
LKSVKLLMRFQFK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgaccagctcctccgcttcctgcacgatcaccagcgcgaaacggactgctcc
gctgaggattccaaccgcatcctcgacagcatcattcaatcgcgcaaacaaaacgacacc
aatgccgaatgcgaccaccacaccgacaacaacaacaatggtctcagcctcgacgagttc
ttccgtttcttgttcctcgtcgatttcaacgatcccctcaaatcccaggtacatcatgat
atgaatgctccgttgtcacattatttcatatatacagggcacaattcctacctgactggg
aatcagctgagcagcgattgcagtgatgtgccaatcataaaggctttgcaacgaggtgtg
cgagtaattgaactagatttatggccaaattcaactaaagatgatatcgacgtagttcat
ggaaggacacttactgctcctgtctcacttatccaatgtttaaagtccataaaagagtat
gcttttgttaaatctgactacccagtcatcataactttagaggaccaccttacaccattc
cttcaagctaaagttgcagagatgatagctcaagtatttggagacatgctctattttcct
caggcagattctctgacagaattccccacaccagaatcgttgaaaggtcgaattcttata
tcaaccaaaccaccaaaagaatatcttgaatccaagcaattcaaggatagtgacagtgag
agggaatcaactgaagaaggatcattatccccatgtgttatccctgaattggaggctgtt
gatgagaagttaaatggaagtgatcttgatgaggaaggcttgaatgctcgtgataaaaaa
tcagaccaacagagtgcacctgagtacaaacgtttgattacaatccatgctgggaagcca
aagggtcatgtaaagcaccacttgaacaatgttgggggcgtgaagcgcttgagcttgagc
gaacaggaacttgaaaaggcttctgctacttatggatcagatattgttagatttacacag
aagaatattatcagggtgtatccaaagggaacacgtgttacctcctcgaattacaggcca
catataggatggatgtatggagctcagatggtggcatttaacatgcaggggcatggaaaa
tcactctggtacatgcaaggcatgtttagagcaaatggcgggtgtggttatgtgaaaaag
cctgcatttctaatagaaaaaggtccacataatgaggtttttgatcctaaaagagcattg
ccagtgaagaaaacattgaaggtgaaagtatatatgggaaatgggtggagctcagatttc
agcaaaacacactttgattccttctctccaccggacttttacacaaaggtttgcattgtt
ggagtaccagctgataaagccaataagaagaccaaggtaattcaagacaactggtttccc
gtctgggacgaagagtttgaatttcccttgactgttccagaactagctttgctccgaata
gaagttcgagaatatgataagcatgaaaaggatgactttggtgggcaaacatgtttgcca
atctctgagttaagatctggtttccgtgcagtccctctatttgatcagaagggcgagcaa
ttaaaatctgtaaagcttttaatgcggtttcagttcaaatga

DBGET integrated database retrieval system