KEGG   Glycine max (soybean): 547972Help
Entry
547972            CDS       T01710                                 

Definition
GmCK1p
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
gmx  Glycine max (soybean)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gmx00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 359 aa AA seqDB search
MAIKAIELLKGSGNHEEIFEVLAAVAASLGDVIDDVNTLQVTPLKGAMTNEVFEVNWPTK
SDGHQRRVLVRLYGEGVEVFFNRVDEIQTFECMSKHGQGPRLLGRFTTGRVEEFIHAKTL
SAADLRDPEISALIASKMREFHNLHMPGAKKAQLWQRMRKWLSHAKSLCSPKETKNFGLD
NLDAEINMLVELLSQGNQQIGFCHNDLQYGNIMMDEDTRAITLIDYEYASYNPIGYDLAN
HFCEMVANYHSDEPHVLDYSKYPGLEERQRFVYNYLSSEGKKPSNSEVDQLVNLAEKYTL
ANHLFWGLWGLISSHVNTIDFDYKEYARQRFQQYWLKKPTLLDSPSIVSQDGIANGVNH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccataaaggcaattgagttgttgaaaggaagcggaaaccatgaagagatatttgaa
gttcttgcagcagtggctgcatctttgggggatgtaatagatgatgtgaacactttgcag
gtaacacctttaaagggggcaatgaccaatgaggtttttgaggtaaattggccaaccaaa
agtgatggtcatcaaagaagggttcttgttcgattatatggtgaaggtgttgaggttttc
ttcaacagggtggatgaaatccaaacctttgagtgcatgtcaaagcatggacagggtcca
cgccttcttgggaggttcaccactggcagagttgaggagttcattcatgccaaaacactc
tcagctgcggacctccgtgaccctgaaatatctgctttgatagcatctaagatgagggag
tttcacaatcttcatatgcctggtgcaaagaaggctcagctttggcagagaatgaggaag
tggcttagtcatgccaaaagtttgtgctcccctaaagaaaccaagaattttggcctggac
aatctagatgctgaaataaatatgcttgtggagttgttatctcaaggaaatcaacagatt
ggtttttgtcacaatgatctacaatatggtaacataatgatggatgaagatacaagagca
atcactttaattgactatgaatatgccagttacaatcctattggatatgatctggcaaat
catttctgtgaaatggtggcaaattaccatagtgacgaacctcatgttcttgactacagt
aaatatcctggtctggaggagcgtcaaaggtttgtttataattatttgagttctgagggt
aagaaaccaagcaatagtgaagtggatcagctagtgaatcttgcagaaaaatacactctt
gcaaaccatctattttggggcttgtggggacttatttcgagtcatgtcaatacaattgac
tttgactacaaggagtatgcgaggcagagatttcagcaatactggttgaagaagcctact
ttattggactcaccaagtatcgtttcccaagatgggattgccaatggtgtgaaccattga

DBGET integrated database retrieval system