KEGG   Glycine max (soybean): 547972Help
Entry
547972            CDS       T01710                                 

Definition
(RefSeq) GmCK1p
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00564  Glycerophospholipid metabolism
gmx01100  Metabolic pathways
Module
gmx_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    547972
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     547972
    2.7.1.82  ethanolamine kinase
     547972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Haspin_kinase APH_6_hur
Motif
Other DBs
NCBI-GeneID: 547972
NCBI-ProteinID: NP_001236799
UniProt: Q42809
Position
2
AA seq 359 aa AA seqDB search
MAIKAIELLKGSGNHEEIFEVLAAVAASLGDVIDDVNTLQVTPLKGAMTNEVFEVNWPTK
SDGHQRRVLVRLYGEGVEVFFNRVDEIQTFECMSKHGQGPRLLGRFTTGRVEEFIHAKTL
SAADLRDPEISALIASKMREFHNLHMPGAKKAQLWQRMRKWLSHAKSLCSPKETKNFGLD
NLDAEINMLVELLSQGNQQIGFCHNDLQYGNIMMDEDTRAITLIDYEYASYNPIGYDLAN
HFCEMVANYHSDEPHVLDYSKYPGLEERQRFVYNYLSSEGKKPSNSEVDQLVNLAEKYTL
ANHLFWGLWGLISSHVNTIDFDYKEYARQRFQQYWLKKPTLLDSPSIVSQDGIANGVNH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccataaaggcaattgagttgttgaaaggaagcggaaaccatgaagagatatttgaa
gttcttgcagcagtggctgcatctttgggggatgtaatagatgatgtgaacactttgcag
gtaacacctttaaagggggcaatgaccaatgaggtttttgaggtaaattggccaaccaaa
agtgatggtcatcaaagaagggttcttgttcgattatatggtgaaggtgttgaggttttc
ttcaacagggtggatgaaatccaaacctttgagtgcatgtcaaagcatggacagggtcca
cgccttcttgggaggttcaccactggcagagttgaggagttcattcatgccaaaacactc
tcagctgcggacctccgtgaccctgaaatatctgctttgatagcatctaagatgagggag
tttcacaatcttcatatgcctggtgcaaagaaggctcagctttggcagagaatgaggaag
tggcttagtcatgccaaaagtttgtgctcccctaaagaaaccaagaattttggcctggac
aatctagatgctgaaataaatatgcttgtggagttgttatctcaaggaaatcaacagatt
ggtttttgtcacaatgatctacaatatggtaacataatgatggatgaagatacaagagca
atcactttaattgactatgaatatgccagttacaatcctattggatatgatctggcaaat
catttctgtgaaatggtggcaaattaccatagtgacgaacctcatgttcttgactacagt
aaatatcctggtctggaggagcgtcaaaggtttgtttataattatttgagttctgagggt
aagaaaccaagcaatagtgaagtggatcagctagtgaatcttgcagaaaaatacactctt
gcaaaccatctattttggggcttgtggggacttatttcgagtcatgtcaatacaattgac
tttgactacaaggagtatgcgaggcagagatttcagcaatactggttgaagaagcctact
ttattggactcaccaagtatcgtttcccaagatgggattgccaatggtgtgaaccattga

DBGET integrated database retrieval system