KEGG   Glycine max (soybean): 548087Help
Entry
548087            CDS       T01710                                 

Definition
dihydroflavonol-4-reductase DFR1
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
gmx  Glycine max (soybean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:gmx00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 347 aa AA seqDB search
MGSASESVCVTGASGFIGSWLVMRLIERGYTVRATVRDPVNMKKVKHLVELPGAKSKLSL
WKADLAEEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTV
RRLIFTSSAGTLNVIERQKPVFDDTCWSDVEFCRRVKMTGWMYFVSKTLAEKEAWKFAKE
QGLDFITIIPPLVVGPFLMPTMPPSLITALSPITGNEDHYSIIKQGQFVHLDDLCLAHIF
LFEEPEVEGRYICSACDATIHDIAKLINQKYPEYKVPTKFKNIPDQLELVRFSSKKITDL
GFKFKYSLEDMYTGAIDTCRDKGLLPKPAEKGLFTKPGETPVNAMHK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagcatccgaaagtgtttgcgttacaggagcttctggtttcatcgggtcatgg
cttgtcatgagactcatcgagcgtggctacaccgttcgagccaccgtacgcgacccagta
aacatgaagaaggtgaagcatttggtggaactaccaggcgcaaagagcaaactgtctctg
tggaaggctgatcttgctgaagagggaagctttgatgaagccattaaaggctgcaccgga
gttttccacgtggccacccccatggactttgaatccaaagaccctgagaatgaagtgata
aagcctacaataaatggggtactagacatcatgaaagcatgcttgaaggcaaaaactgtg
cgaaggctaatattcacgtcctcagccggaaccctcaacgttattgagcgccaaaagccc
gttttcgacgacacatgctggagtgacgttgagttttgccgtagagttaagatgactggt
tggatgtattttgtttctaaaacactggcggagaaagaagcatggaaatttgccaaagag
cagggcctggacttcatcactatcattccacctcttgttgtcggtccctttctgatgcca
accatgccacctagcctaatcacggctctatcgccaatcacaggaaatgaggaccattac
tcgatcataaagcaaggtcaattcgtccacttagatgatctctgtcttgctcacatattt
ctgtttgaggaaccagaagtggaagggaggtacatatgcagtgcatgtgacgctaccatt
catgacattgccaaattaattaaccaaaaataccctgagtacaaggtccccaccaagttc
aagaatattccagatcaattggagcttgtgagattttcttccaagaagatcacagacttg
ggattcaaatttaaatacagcttagaggacatgtacactggagcaattgacacatgcaga
gacaaagggcttcttccgaaacctgcagaaaaagggctttttactaaacctggagaaact
ccagtgaatgccatgcataaatag

DBGET integrated database retrieval system