KEGG   Glycine max (soybean): 548095Help
Entry
548095            CDS       T01710                                 

Gene name
HEMB, ALADH, Alad
Definition
(RefSeq) aminolevulinate, delta-, dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00860  Porphyrin and chlorophyll metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Module
gmx_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    548095 (HEMB)
Enzymes [BR:gmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     548095 (HEMB)
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   548095 (HEMB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 548095
NCBI-ProteinID: NP_001238737
UniProt: P43210
Position
4
AA seq 412 aa AA seqDB search
MASSIPNAPSAFNSQSYVGLRAPLRTFNFSSPQAAKIPRSQRLFVVRASDSEFEAAVVAG
KVPPAPPVRPRPAAPVGTPVVPSLPLHRRPRRNRKSPALRSAFQETSISPANFVYPLFIH
EGEEDTPIGAMPGCYRLGWRHGLVEEVAKARDVGVNSVVLFPKIPDALKSPTGDEAYNEN
GLVPRTIRLLKDKYPDLVIYTDVALDPYSSDGHDGIVREDGVIMNDETVHQLCKQAVAQA
QAGADVVSPSDMMDGRVGALRAALDAEGFQHVSIMSYTAKYASSFYGPFREALDSNPRFG
DKKTYQMNPANYREALTEMREDESEGADILLVKPGLPYLDIIRLLRDNSPLPIAAYQVSG
EYAMIKAAGALKMIDEEKVMMESLMCLRRAGADIILTYSALQAARCLCGEKR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaatccctaatgcgccttctgcgttcaattctcagagctacgttggtctc
agagcgccactgaggaccttcaacttttcttctcctcaagctgccaaaattcctcgctcc
caacgccttttcgtcgtcagagcctccgattcggagttcgaagccgccgttgtcgccggt
aaggttccgccggcgcctcccgtgcggcccagaccggcggctccggttggaacaccggtg
gttccttcacttccacttcaccggcgtcctcgtcggaaccggaagtcgccggcgcttcgg
tcggcttttcaggaaacgagcatttcgccggcgaatttcgtgtatccgcttttcattcac
gaaggtgaagaggatactccaattggggctatgcctggatgctacaggcttgggtggagg
catggacttgtagaagaggttgcaaaagcacgggatgttggtgttaatagtgttgtgctc
ttccccaaaattccagatgctttgaagtctcccacaggagatgaagcatacaatgaaaat
ggtttagtgcctcgaacaatacgtttgctcaaggataagtacccagaccttgttatctat
acagatgttgcattagatccttattcatcagatgggcatgatggcatagttagagaagat
ggagttattatgaatgatgagacagttcatcagctatgtaaacaagctgtagcccaggcc
caagctggagcagatgttgtcagtcctagtgatatgatggatggtcgggtaggagcactg
cgtgcagctctggatgctgaaggctttcagcatgtttctataatgtcctatacagcaaag
tatgcaagttctttttatggtccatttagagaggcactagactcaaacccccggtttgga
gacaagaaaacttatcagatgaacccagctaattacagagaggctctgactgagatgcgg
gaggatgaatctgaaggagctgacattctcttggtgaagcctggtcttccttacttggat
atcataaggctgctcagggataattctcctttgccaattgcagcataccaggtttctggt
gaatatgcaatgataaaggctgccggtgctctcaaaatgatagacgaagaaaaggttatg
atggagtcactgatgtgcctccgaagggccggtgctgatatcatcctcacatattctgct
ctgcaagctgccagatgtttgtgtggagagaagaggtga

DBGET integrated database retrieval system