KEGG   Glycine max (soybean): 732545Help
Entry
732545            CDS       T01710                                 

Gene name
CHI1B1, CHI2, CHI2-B
Definition
chalcone isomerase 1B1 (EC:5.5.1.6)
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
gmx  Glycine max (soybean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:gmx00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 226 aa AA seqDB search
MATPASITNVTVEFLQFPALVTPPGSTKSYFLGGAGVRGLNIQEEFVKFTGIGVYLEDKA
VSSLAAKWKGKSAAELLDSLDFYRDIIKGPFEKLIRGSKLRTLDGREYVRKVSENCVAHM
QSVGTYSDEEEKAIEEFRNAFKDQNFPPGSTVFYKQSPTGTLGLSFSKDETIPEHEHAVI
DNKPLSEAVLETMIGEIPVSPALKESLATRFHQFFKELEANPNIEN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggccacaccagcatccatcactaatgtcactgtggagttccttcaattccccgcactg
gtgacacctcctggctctaccaaatcctatttccttggcggcgcaggggtgagagggttg
aatattcaagaagaatttgtgaagttcacgggaataggtgtttatttggaagacaaggcc
gtgtcatcactcgctgccaaatggaagggcaagagtgcagctgaattgctcgactccctt
gacttctacagagatatcatcaaaggcccctttgagaagttaattcgagggtcaaagtta
agaacattggatggtcgtgaatacgtaaggaaggtatcagagaactgtgtggcacatatg
caatctgttgggacttacagtgatgaggaggaaaaagctattgaggaatttagaaatgct
ttcaaggatcaaaatttcccaccaggctccactgttttctacaaacaatcacccactgga
acattggggcttagtttctcgaaagatgagacaataccagaacatgagcatgcagtgata
gacaacaagccactttcggaggcagtgctggagactatgatcggagagattcctgtttcc
cctgctttgaaagagagtttggctacaaggtttcatcagttcttcaaagagttagaggcc
aatcccaacattgaaaactga

DBGET integrated database retrieval system