KEGG   Glycine max (soybean): 732546Help
Entry
732546            CDS       T01710                                 

Gene name
CHI2-A, CHI, CHI2, CHI3
Definition
chalcone isomerase 2 (EC:5.5.1.6)
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
gmx  Glycine max (soybean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    732546 (CHI2-A)
Enzymes [BR:gmx01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     732546 (CHI2-A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 226 aa AA seqDB search
MAFPSVTSVTVENVTFPPTVKPPCSPNTFFLAGAGVRGLQIHHAFVKFTAICIYLQYDAL
SFLSVKWKTKSTHQLTESDQFFSDIVTGPFEKFMQVTMIKPLTGQQYSEKVAENCVAIWR
SLGIYTDSEAEAIDKFLSVFKDLTFPPGSSILFTVSPNGSLTISFSGDETIPEVTSAVIE
NKLLSEAVLESMIGKNGVSPAAKQSLASRLSHLFKEPGVCDPQSHK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcatttccgtccgtaacctctgtaactgtggagaacgtgacattccctcccaccgtg
aagcctccctgctcccccaacaccttcttcctcgccggcgccggcgtcaggggcctccaa
attcatcacgctttcgttaaattcactgccatctgcatttacctccaatacgacgccctt
tccttcctctccgttaagtggaaaaccaagtctactcaccagttaacggaatccgaccaa
ttcttctcagatatcgttacaggtccattcgagaaatttatgcaggtgacaatgatcaaa
cccttgacggggcagcaatactcagagaaagtggcagaaaattgtgtggccatttggagg
tctcttgggatttatacagattcagaagccgaagcaatagacaagtttctttctgttttc
aaagacctaacattcccaccaggctcctctatccttttcactgtctcacccaatggatca
ttaacgataagtttctctggtgatgaaaccattccagaagttacgagtgctgttatagag
aataaactactctcagaggctgtgttggagtcaatgataggtaagaatggcgtttcccct
gcagcaaaacagagtttggcctccagattatctcacttattcaaagagcctggggtttgt
gaccctcaatctcataagtga

DBGET integrated database retrieval system