KEGG   Glycine max (soybean): 732575Help
Entry
732575            CDS       T01710                                 

Gene name
CHS1, Gmachs1, ICHS1
Definition
chalcone synthase 1
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
gmx  Glycine max (soybean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    732575 (CHS1)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    732575 (CHS1)
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     732575 (CHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 388 aa AA seqDB search
MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC
DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP
KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN
NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLPVEKPLFQLVW
TAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWI
AHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTT
GEGLDWGVLFGFGPGLTVETVVLRSVTL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtgttgaagagattcgtaaggcgcaacgtgcagaaggccctgccactgtcatg
gctattggcaccgccactcctcccaactgcgtggatcagagtacctatcctgactattat
ttccgcatcaccaacagcgagcacatgaccgagctcaaagaaaaattcaagcgcatgtgt
gataagtcgatgattaagaagcgatacatgtacttaaacgaagagatcctgaaagagaat
ccgagtgtttgtgcttacatggcaccttcgttggatgcaaggcaagacatggtggttgtg
gaggtaccaaagttgggaaaagaggctgcaactaaggcaatcaaggaatggggtcaaccc
aagtccaagattacccatctcatcttttgcaccactagtggtgtcgacatgcctggtgct
gattatcagctcactaaactattaggccttcgcccctccgtcaagcgttacatgatgtac
caacaaggctgctttgccggtggcacggtgcttcgtttggccaaagacctcgctgaaaac
aacaagggtgctcgcgtgcttgtcgtttgttctgagatcaccgcagtcacatttcgcggc
ccaactgacacccatcttgatagccttgtgggtcaagccttgtttggagatggtgcagcc
gctgtcattgttggatcagaccccttaccagttgaaaagcctttgtttcagcttgtctgg
actgcccagacaatccttccagacagtgaaggggctattgatggacaccttcgcgaagtt
ggtctcactttccatctcctcaaggatgttcctggactcatctccaagaatattgagaag
gccttggttgaagccttccaacccttgggaatctccgattacaattctatcttctggatt
gcacaccctggtggacccgcaattttggaccaagttgaggctaagttaggcctgaagcct
gaaaaaatggaagctactagacatgtgctcagcgagtatggtaacatgtcaagtgcatgc
gtgctattcatcttggatcaaatgaggaagaaatcaatagaaaatggacttggcacaacc
ggtgaaggtcttgactggggtgtgctatttggtttcggccctggactcaccgttgagact
gttgtgctccgcagtgtcactctctga

DBGET integrated database retrieval system