KEGG   Glycine max (soybean): 732610Help
Entry
732610            CDS       T01710                                 

Gene name
TSA, GmTSA
Definition
tryptophan synthase alpha subunit
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gmx  Glycine max (soybean)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    732610 (TSA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    732610 (TSA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    732610 (TSA)
Enzymes [BR:gmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     732610 (TSA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 311 aa AA seqDB search
MALALKSSCLLQLKKPEAGFNVCFSSKKAIISVKRYTPVAAIRIMDAVGLSATFTRLKKE
GKVAFIPYITAGDPDLSTTAEALKLLDSCGSDIIELGIPYSDPLADGPVIQAAATRSLAK
GTNFNVIIDMLKEVVPQLSCPIALFTYYNPILKRGTEKFMSTIRDTGVHGLVVPDVPLEE
TETLRTEAKKHGIELVLLTTPTTPPDRMKAIVDVAEGFVYLVSSVGVTGARASVSGSVQS
LLQEIKEATTKPVAVGFGISKPEHVKQVAGWGADGVIVGSAIVKVLGEAKSPQEGLKELE
VLTRSLKAALP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgccctgaagtcaagttgcttattgcaattgaagaaacctgaggctggtttc
aatgtttgtttttcatctaagaaagctataatctccgtgaaaagatacactccggtggcc
gctatcaggatcatggacgcagtgggactctctgcaacattcaccagattgaaaaaagaa
ggaaaagtggctttcatcccatatatcactgctggtgatcctgacctttcaaccactgca
gaagcactgaaattgcttgattcatgcgggtctgacataattgagctaggcattccatac
tctgatcctttggcagatggtcctgttatccaggctgctgctacaagatctttagcaaag
gggaccaattttaatgtgattattgatatgttgaaggaggttgttccgcaactgtcatgt
ccaattgcactgtttacatattacaatccaatactgaagcgtggtactgagaaatttatg
tccaccataagagacactggcgtacatgggcttgtagtgccagatgtccctctggaggag
acggaaactttaaggacagaagctaagaaacatggaattgaactggtactcctcacaaca
cccaccactccaccagaccgaatgaaagccattgttgatgtggcagaaggatttgtgtat
cttgtgagctcagtgggggtcactggagcccgcgcatctgttagtggttctgttcagtcc
cttctacaggaaattaaagaggcaactactaaacctgtcgcagttggttttggaatatca
aaacctgagcatgtgaaacaggtagcgggatggggagctgatggtgtgattgttggcagt
gctatagtgaaggtgcttggtgaggccaaatctcctcaagagggactgaaagaactggaa
gttttaacccgctccttaaaagcagcacttccttga

DBGET integrated database retrieval system