KEGG   Glycine max (soybean): 732610Help
Entry
732610            CDS       T01710                                 

Gene name
TSA, GmTSA
Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00260  Glycine, serine and threonine metabolism
gmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01230  Biosynthesis of amino acids
Module
gmx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    732610 (TSA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    732610 (TSA)
Enzymes [BR:gmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     732610 (TSA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB Ribul_P_3_epim NanE BtpA TMP-TENI IGPS
Motif
Other DBs
NCBI-GeneID: 732610
NCBI-ProteinID: XP_003554276
UniProt: I1N9L7
Position
19
AA seq 311 aa AA seqDB search
MALALKSSCLLQLKKPEAGFNVCFSSKKAIISVKRYTPVAAIRIMDAVGLSATFTRLKKE
GKVAFIPYITAGDPDLSTTAEALKLLDSCGSDIIELGIPYSDPLADGPVIQAAATRSLAK
GTNFNVIIDMLKEVVPQLSCPIALFTYYNPILKRGTEKFMSTIRDTGVHGLVVPDVPLEE
TETLRTEAKKHGIELVLLTTPTTPPDRMKAIVDVAEGFVYLVSSVGVTGARASVSGSVQS
LLQEIKEATTKPVAVGFGISKPEHVKQVAGWGADGVIVGSAIVKVLGEAKSPQEGLKELE
VLTRSLKAALP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgccctgaagtcaagttgcttattgcaattgaagaaacctgaggctggtttc
aatgtttgtttttcatctaagaaagctataatctccgtgaaaagatacactccggtggcc
gctatcaggatcatggacgcagtgggactctctgcaacattcaccagattgaaaaaagaa
ggaaaagtggctttcatcccatatatcactgctggtgatcctgacctttcaaccactgca
gaagcactgaaattgcttgattcatgcgggtctgacataattgagctaggcattccatac
tctgatcctttggcagatggtcctgttatccaggctgctgctacaagatctttagcaaag
gggaccaattttaatgtgattattgatatgttgaaggaggttgttccgcaactgtcatgt
ccaattgcactgtttacatattacaatccaatactgaagcgtggtactgagaaatttatg
tccaccataagagacactggcgtacatgggcttgtagtgccagatgtccctctggaggag
acggaaactttaaggacagaagctaagaaacatggaattgaactggtactcctcacaaca
cccaccactccaccagaccgaatgaaagccattgttgatgtggcagaaggatttgtgtat
cttgtgagctcagtgggggtcactggagcccgcgcatctgttagtggttctgttcagtcc
cttctacaggaaattaaagaggcaactactaaacctgtcgcagttggttttggaatatca
aaacctgagcatgtgaaacaggtagcgggatggggagctgatggtgtgattgttggcagt
gctatagtgaaggtgcttggtgaggccaaatctcctcaagagggactgaaagaactggaa
gttttaacccgctccttaaaagcagcacttccttga

DBGET integrated database retrieval system