KEGG   Glycine max (soybean): 732628Help
Entry
732628            CDS       T01710                                 

Gene name
MS
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gmx  Glycine max (soybean)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:gmx01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gmx00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gmx00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 567 aa AA seqDB search
MDIGTYGYPTPAVKKIESYYDVPEGVDIRGRYDAEFAKILTKDALKFVADLQREFRNHIK
YALECRREAKKKYNEGALPEFDPATRYIREQEWVCAPVPPAVADRKVEITGPVDRKMVIN
ALNSGAKVFMADFEDALSPGWENLMRGQVNLKDAVAGTISLHDKARNRVYKLNDQTAKLF
VRPRGWHLPEAHILIDGEPATGCLVDFGLYFYHSYSAFRRTQGAGFGPFFYLPKMEHSRE
AKIWNNVFEKAEKVAGIERGSIRATVLIETLPAVFQMNEILYELKDHSVGLNCGRWDYIF
SYVKTFQAHPDRLLPDRVLVGMTQHFMKSYSDLLIRTCHRRGVHAMGGMAAQIPIKEDPV
ANEVALELVRKDKLREVKAGHDGTWAAHPGLIPACMEIFNNNMGNASNQIDTVKREDGAN
ITEQDLLQIPRGARTMEGLRLNTRVGIQYVAAWLTGSGSVPLYNLMEDAATAEISRVQNW
QWLKYGVELNGDGLGVKVNKELFGRVVEEEMARIEKEVGTEKFKKGMYKEACKIFTRQCT
SPMLDDFLTLDAYNYIVVHHPRETSKL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggacatcggaacctatggctatcctacaccagcagtgaaaaagattgagtcttactat
gatgtgccagagggagtggatattcggggaagatatgatgcagagtttgcaaaaatcctc
acaaaagatgctttgaaattcgttgctgacttgcaacgtgagttcaggaaccatatcaag
tatgcattagagtgcagaagagaagcaaagaagaagtacaatgaaggggctcttccagag
tttgatcctgccacaaggtacatcagagagcaagagtgggtgtgtgcacctgttccacca
gcagttgctgatagaaaagttgaaatcactggccctgtggatagaaagatggtcatcaat
gctctcaactctggagctaaagtctttatggctgattttgaagatgcactgtcaccaggc
tgggaaaatcttatgagaggccaagtgaacttaaaggatgctgtggctgggaccataagc
ttgcatgacaaagcaagaaacagggtttacaagctcaatgatcaaacagcaaagcttttt
gtgcgaccaagaggttggcacctaccggaggcacatattctgattgatggtgaacctgca
actggttgccttgttgattttggcctctatttctaccacagctactcagcattccggcgc
actcaaggtgctggctttggccctttcttttatcttcccaagatggagcattcaagggaa
gctaagatttggaacaatgtgtttgagaaagctgagaaggtagcaggcatcgaaagagga
agcataagggcaactgttctgatagaaacacttcctgcagtgtttcaaatgaatgaaatt
ttgtatgaactgaaggaccattcagtgggtttgaactgtgggcgttgggattacattttc
agttatgttaagaccttccaagctcatccagatcgcctcttaccagatagggtcctagtt
ggcatgactcaacacttcatgaaaagttattctgatcttctcatcaggacgtgccacagg
cgcggcgtgcatgctatgggaggaatggcagcgcagattccaatcaaagaagatccagtg
gctaacgaggtagcactggaacttgtaaggaaggacaagcttagagaagtgaaggcaggg
cacgatggaacttgggctgcgcaccctggtctcattccagcctgcatggagattttcaac
aacaacatgggcaatgcttccaaccagatagacacagtgaaacgcgaagatggggcaaac
atcaccgagcaagacctcttgcagataccaagaggagcccgcaccatggaaggtctcaga
ttgaacacaagggtgggaattcagtacgtggcggcgtggctcaccggaagcggttcggtg
cctctatacaacctcatggaggatgctgccactgctgagatcagcagggtgcagaattgg
cagtggctcaagtatggagtggagctcaatggggatggtcttggagtgaaagtgaacaaa
gaactttttggtagggttgttgaagaagagatggctaggattgaaaaggaagtggggaca
gagaagttcaagaagggaatgtacaaggaggcttgcaagatcttcactcgccaatgcacg
tcaccaatgcttgatgattttctcactctggatgcttataattacattgtcgtgcatcac
ccgagggaaacatcaaagctttga

DBGET integrated database retrieval system