KEGG   Glaciecola nitratireducens: GNIT_0058Help
Entry
GNIT_0058         CDS       T01632                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gni  Glaciecola nitratireducens
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gni03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64253..65065
Genome map
AA seq 270 aa AA seqDB search
MPELPEVEVTKLGIAPFLEGNVISKIVVHQPQLRWIVPYEVQLACQQTINSVTRRAKYLF
INTDVGALVMHLGMSGKMRVVDTHLERKKHDHIEIELMTGKKLVFNDARRFGSCLWQSPT
EPPLKILRSLGPEPLTAEFDAKVLFSKSRGKLSPVKSFIMDNAVVVGVGNIYANESLFKS
GIDPRRAAGKVSLKRYKLLTENIKQVLANAISQGGTTLKDFAQADGNPGYFAQQLLVYGR
AGEACEICETPIRSVVIGQRNTFYCIQCQK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattacctgaagtcgaagtcactaaactgggtattgcgccttttttggaaggc
aatgtcattagtaaaattgtcgttcatcagccacaattgcgatggattgtgccatatgag
gtgcagcttgcatgccaacaaaccattaactcagtgacgcgccgagcaaagtatttattc
atcaacactgacgttggcgccttagtcatgcacttagggatgtcgggtaagatgcgggtg
gttgatacgcaccttgagcgcaaaaagcatgatcatattgaaatagaattaatgacaggt
aagaagttagtgtttaacgatgcgcgccgctttggttcttgtttatggcaatcgccaact
gaaccgcctttgaagatattgcgctccttaggccccgaaccattgaccgctgagtttgac
gctaaagtattgtttagtaaatcgcgaggcaagctgtcgccagttaagagcttcattatg
gacaatgctgtggtagttggcgttgggaatatttacgctaatgaatcgctgtttaagtca
ggtattgacccacgtagagcggcaggaaaagtgagccttaaacgctacaaattactgaca
gagaatattaaacaggtgttagcgaatgcaatcagtcaaggtggaacaacgttaaaggac
tttgcccaagccgatggcaacccgggctactttgcacagcagttgctggtttatgggcgt
gctggtgaagcgtgtgaaatttgtgaaacacctattcgttctgtcgttattggtcaacgt
aatacgttttactgtatccagtgtcaaaaatag

DBGET integrated database retrieval system