KEGG   Glaciecola nitratireducens: GNIT_0211Help
Entry
GNIT_0211         CDS       T01632                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gni  Glaciecola nitratireducens
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gni00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
239901..240596
Genome map
AA seq 231 aa AA seqDB search
MSKIKSENTPEITPNDMSEMFAKPLGNLFIVAAPSGAGKSTLIKEILSKSTDEQRMQLSV
SHTTRAPRKGEHNGVEYHFVDHAEFKSMIGQDAFYEYAEVFGNYYGTSKAAISDKLQQGI
DVFLDIDWQGARQVKVQNPSVISIFIVPPSVEALQARLSGRGQDSEEIIAKRMAEAKSEI
SHYNEFDYVIVNDQLETAHKEFEAIVMTQRLNLSKQKVRHKALFAELLATK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcaagtccgagaacacgcccgaaatcactccgaatgatatgtctgaaatg
ttcgctaaaccattaggcaatctttttatcgttgctgcgccctcaggtgcaggtaagtca
acgttaattaaagaaattttgagtaagtctaccgatgagcaacgcatgcaactatcggtc
tcacacaccacacgcgcacctcgcaagggggagcacaatggtgttgaatatcactttgtc
gatcacgctgaatttaagagcatgattggtcaagacgctttttatgaatatgctgaggtt
tttggcaattattacggcacgtctaaagctgctattagcgataagctccagcaaggtatt
gacgtgtttttggacattgactggcagggtgcgcgtcaggttaaggtacaaaatccatct
gtgataagtatctttattgtgccgccttcagttgaagccctacaggcaagattatctggt
cgcggacaggattctgaagagatcattgcaaaacggatggctgaggcaaaatcagaaatt
tcacattacaacgaatttgattatgtgattgttaatgaccaactagaaacggcgcacaaa
gagtttgaagcgattgttatgacgcaacgtttgaacttgagtaagcaaaaagtaaggcat
aaagccctttttgctgagttgttggccactaaataa

DBGET integrated database retrieval system