KEGG   Glaciecola nitratireducens: GNIT_0490Help
Entry
GNIT_0490         CDS       T01632                                 

Gene name
pldB
Definition
alpha/beta hydrolase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
gni  Glaciecola nitratireducens
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GNIT_0490 (pldB)
Enzymes [BR:gni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GNIT_0490 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543912..544937
Genome map
AA seq 341 aa AA seqDB search
MQLTKETELPEKFDSVIKPWFKTKMTSGFWTLADGTSLHYRYAHHSAAKSIIVISSGRVE
CAAKYAEIIYDLHQNGHSVFIHDHRGQGLSTRLDENPHWGYVEDFNQYVSDFGSMIDDVL
LPMLNENYVKADHNATNTEALMLNHALPPLHLLCHSMGSAIGVLLVKARPELFAKAVFCS
PMFGITPPLPPWIANFLVRLGVRFNKLRGKRTSYFFGQSDYSPTAFYKNRLMSSKLRYEI
FRRTYAEQPELQLGGVTYEWLNASLIAMKEIREQASKIEQPCLVLYSGADTVVANEDIEQ
VISDFKHCESTLIPEALHELLFEKDKFRTPVLTKILSYFSP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaacgaaagagacagaattgccagaaaagtttgatagcgttatcaaaccctgg
ttcaaaaccaagatgacgtctgggttttggactttagctgacggcacttcgctgcattat
cgatatgcgcatcacagtgcagccaaatccattattgtaatttcctctggccgcgtggag
tgtgcagctaaatacgccgaaattatctatgatttacatcaaaatggtcattcggtgttt
attcatgatcatcgtggtcaaggcttgtctactcgtttagatgagaatcctcactggggt
tatgttgaggattttaatcagtatgtaagtgattttggcagcatgattgacgacgttttg
ctgccgatgttaaatgagaattatgtaaaagcggatcacaatgcaacaaatactgaagcg
ctaatgcttaaccacgcgcttccaccactgcatctgctttgtcactcaatgggaagcgca
attggtgtgttgcttgtgaaagctcgtcctgaactttttgctaaagccgttttttgctcg
cctatgtttgggataaccccaccattgccgccatggattgcaaactttttagttcgactt
ggtgttcgtttcaacaagttgagaggaaaacggacgagttacttttttgggcaaagcgac
tacagtccaaccgcgttctacaaaaaccgtttgatgagcagtaagcttagatatgagatt
tttcgtagaacctatgcagagcaacctgagttgcagttaggtggagtaacctacgaatgg
ttaaatgcgtctttaattgcgatgaaagaaatacgtgaacaggccagcaaaattgaacag
ccttgccttgttctctattctggcgccgacacggtagtggcgaatgaagatattgaacag
gtaatcagtgacttcaaacactgtgaatcaacattgatacccgaagcattgcatgagtta
ctattcgaaaaagacaagtttagaacgcctgttttaacgaaaatactgagttatttttca
ccgtag

DBGET integrated database retrieval system