KEGG   Glaciecola nitratireducens: GNIT_0517Help
Entry
GNIT_0517         CDS       T01632                                 

Definition
PAS sensor protein (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
gni  Glaciecola nitratireducens
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:gni00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GNIT_0517
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GNIT_0517
Enzymes [BR:gni01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     GNIT_0517
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GNIT_0517
Two-component system [BR:gni02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GNIT_0517
Bacterial motility proteins [BR:gni02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GNIT_0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
569487..573794
Genome map
AA seq 1435 aa AA seqDB search
MKKRSERDTPNAIQTDQKKRSGPEEKASVLLTKNSVPVVGIGASAGGLETFIMFFDAMPA
KSGMAFVLIQHLDPNHKSLTAEIIAKHTLMPVHQVDDQMHVEANKVYVIPPNKDLTISQN
ILLLSEPSQAHGQRMPIDIFLRSLAKDKQENAICIILSGTGTDGSLGIKSIKDKGGLVLV
QAPETSKFDGMPQSAIDTGFVDCTLPVQKMPSELLLYFQSLQQLIISDIPVDLVHEQLDK
ILSALRLQTKYDFSNYKKGTLTRRIERRMGLKHLTDFAEYAHIVQQSHEEAQLLLKDLLI
SVTDFFREPEAYKQLENDVVQKIINTKAPDDVIRVWTPGCATGEEPYSIAMVILEQLQLA
KKHNEVQIFASDIDEQAISVARAGRYPVNITSDISTERLQQFFIKKDNHYQVNKTLRDCV
VFATQNLISDPPFSKVDLISCRNLLIYLEPAIQKKIISMFHFALNEGGYLFLGSAETIGQ
HEDLFQPLSKKLRLYRRVGKTKSETISFPTLSDFSKQPQMSYPINQGTQEAAQYGKITQQ
LLLQHYAPFAVLINKNFDILYVNGQSGRYLEMTTGKPSQDLISVLREGIRSKLRAAVQLA
MTNGEMIEVTTRVKRDANYYPIQLSVHPIHTLKSGEDLLLISFSEVVESNQINVIASATP
DELQHTNLLHQLEEELAEAKDDLRTCLEDMASSTEELKVSHEEVLSMNEELQSSNEELET
SKEELQSLNEELTTVNNQLQNKVEELAIANDDMTNLLESADIAALFLDVKFCIKRFTPAM
RALFQLIKSDVGRPISDISHQFVTLDLVKEAELTLKNRLMNEIEVKTTDDKCYIVRISPF
RTNDGEIEGVVVTFFDITRLNQIKSSLSSSRERIELLLKSTGEAIYGVDVSGKCTFVNAK
LVQDLGFTEQELIGRDSHTIFHHTRSDGSDYPWSDCFVYQCLKDQKPHRGANDLVWRKDG
TSFPISYSVGPIIEHGELRGAVVIFRDMTKEYASINKLDYQARHDALTGLINRREFDERL
ERVLQNSPEDQDQHVLCYLDLDQFKVINDACGHLAGDELLRQLSNVLQSHVRKRDTLARL
GGDEFGLLMEHCDLHEGKRVANGMRDAVANYRFFWQGNTHMVGVSIGLVEIIGDGQDKTD
LLKAADAACYAAKENGRNRVHVYSEQDTNMAARHGQMKWVARINLALENNRFLLVLQPIV
PINGVDTNKLSYEVLIRMRDGDNIIQPDDFLGAAERYNLSSKVDLWVIRNTFNWMTDNKH
QLENVALININISGQSLGDQEFLKHVVNALKAKPIPTGKICFEITETAAITNFTNANSFM
HALKNLGCEFALDDFGTGLSSFEYLKALPVEYIKIAGLFVKDIATDSVNLAMVKAISDLG
HEMNKKVIAESVENKEILDCLVELGVDFAQGYFFGKAVPLSEIKLNESDITDERK
NT seq 4308 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgctcagaaagggacacgcctaacgcgattcaaaccgatcaaaaaaagcgc
agtggaccagaagaaaaagcctcagttttacttacaaaaaactcagtccccgttgtcggt
atcggcgcctccgctggcggcttagaaactttcattatgttctttgatgctatgccggca
aaaagtggtatggcgtttgtcttgatccagcaccttgatccgaatcataagagcctgacg
gctgagataattgcgaaacataccttaatgccagtgcatcaggttgacgatcaaatgcat
gttgaagcaaataaagtgtacgtaatcccaccaaataaagatttaactatcagtcagaat
attctgctactaagcgagccaagtcaagcgcatggacagaggatgccaattgatattttt
ttacgatcgttggcaaaagataaacaagaaaatgctatttgcatcatcctttctggaaca
gggactgatggttcactgggcattaaatcgataaaagacaagggaggattggtattagtg
caggctcctgaaacctcgaaatttgatggcatgccgcaaagtgctattgataccggattt
gttgactgtactttaccagtccaaaaaatgccgagtgaattgttattatatttccagagt
cttcagcaattaatcataagcgacattcctgttgatttggttcacgagcaattagacaaa
attctatctgccctgcgattgcaaactaaatatgatttttcaaactataaaaaaggcact
ttaacgcgtcgcatagaacgtcgcatgggacttaaacacctgactgattttgctgaatat
gcgcatatagttcaacaaagccacgaagaagctcaactattattgaaagatttattaatc
agtgtgactgatttcttccgtgaacctgaagcttataaacaactcgaaaacgacgttgtt
caaaaaatcatcaacactaaagcacctgatgatgtgattcgggtatggacgcccggatgc
gcaacgggtgaagagccctattcgattgcgatggttatactggagcagttacaactcgca
aaaaagcacaacgaagtgcagatttttgcatccgatattgatgaacaggctatcagcgtt
gcgcgcgcgggcaggtatcccgttaacattacctctgatatctctactgagcgcttgcag
caattttttattaaaaaggacaatcactaccaagtgaataagacgttgcgagattgcgtg
gtgtttgcgacacaaaatttaatcagtgacccgcctttttcaaaagtagatctcattagc
tgtcgtaacttgttgatatatctcgagccggctattcagaaaaaaatcatttcgatgttc
cactttgctctcaatgaagggggctatctgtttttaggtagtgctgaaacaattggtcaa
catgaggacctatttcagcctctctccaaaaaactgcgtttataccgtcgcgttgggaag
acaaaaagcgagacgatttctttccccactttgtcagattttagtaagcagccacaaatg
agttatccaataaatcaaggtacgcaagaagcagcccagtatggcaaaattacgcagcag
ttgttacttcaacattatgcgccttttgccgttctaattaataagaatttcgacattctt
tacgtcaatggtcagtctggacgttatttggaaatgacgacggggaagccctcacaggac
ctgatctcagttttgcgcgaaggtatacgtagcaagcttcgcgctgcagttcagttagct
atgacgaacggtgaaatgatcgaggtgacgacaagggtcaagcgcgacgccaattattat
ccaatccaactttcggttcacccgatacatacgttaaaatcgggtgaagatttactattg
attagctttagtgaagttgttgagtctaaccagataaatgtcattgcatcggcaacgcct
gacgagttgcagcacactaatctactccatcaattagaagaggagttagctgaggctaaa
gacgacctgcgaacctgtcttgaggatatggcatcttctactgaagagttaaaagtatcg
cacgaagaagttttgtcgatgaatgaggaactgcagtcgtcgaatgaagagctagagact
tccaaagaagaattacagtcactaaatgaagagctgaccacggttaacaatcagctccaa
aacaaggtcgaagagttagccattgctaatgatgatatgactaacctgctggagagtgct
gatatcgcggcgttatttttagacgttaagttttgcattaaacgctttacgccagccatg
cgcgcgttgtttcagctgataaaatccgatgttggaagacccattagcgatatctcccat
cagttcgtaacacttgatttagtgaaagaggccgagttaacgcttaagaatcgcctaatg
aatgagattgaggtcaaaacgaccgacgataagtgctatatcgttcgaatttcacccttt
cgcaccaatgacggtgagatagaaggcgtggtcgtgacattttttgatattacacgcctt
aatcaaattaaaagctcgttaagcagttccagagagcgtatcgagttgctcttaaaatca
acgggtgaggccatctatggcgttgatgtctcaggcaaatgtacgtttgttaatgccaag
cttgtccaagatctaggatttacggaacaagagctaattggtagagattcacatacgata
tttcatcacacacgttctgatggttctgattacccgtggtctgattgttttgtttatcag
tgccttaaggatcaaaaaccccatcgcggtgcaaatgatttggtttggcgtaaagatggt
acatcgttccccatttcatattcagtggggccgatcattgaacatggcgagctgaggggc
gccgtcgtgatttttagagatatgaccaaagagtatgcctcaatcaataaattagactac
caagcgcgtcatgacgccttaacaggccttattaatcgtcgggagtttgatgagcgccta
gaacgcgtgctacaaaacagtcctgaagatcaagatcagcatgttttatgttatttagac
ttagatcagtttaaggtgatcaatgatgcctgcggacatttggcgggtgacgaattatta
agacagctttcaaatgtgttacaaagtcatgttagaaagcgagatactttagctaggctt
ggtggtgacgagtttggcttattaatggaacattgcgacctgcatgaaggcaagcgtgtc
gctaacggtatgcgtgatgctgtggctaattatcgatttttttggcaaggaaacactcat
atggtgggcgtcagtataggcttagtggaaataattggcgatggacaagataagactgat
ttattaaaggctgctgatgcagcgtgctacgcagcaaaagaaaatggccgtaacagggtt
catgtttattcggaacaagatacgaatatggctgctcggcacggacagatgaaatgggtc
gcgcgcatcaacttagcactagaaaacaaccgctttttactcgtcttacaacccatcgtt
ccaatcaatggtgttgataccaataagctttcttatgaggtattaatccgcatgcgagac
ggtgacaatattattcaaccagacgattttctgggagcggcggaacgctataacttgtca
tccaaagttgacttatgggtcattcgtaacacatttaattggatgactgataacaaacat
caactagagaatgttgccttaatcaacatcaatatttctggacagtcgttgggggatcaa
gagtttttaaaacacgtcgttaacgcgctgaaggctaaaccgatacctactggaaaaatc
tgttttgaaataactgaaactgcggccatcaccaattttaccaacgccaacagctttatg
catgcccttaaaaatttgggttgtgagtttgcactggatgatttcggaacgggcttatcg
tcttttgaatatttgaaggctctgcctgttgaatatattaaaatcgctggcttgtttgtc
aaagatattgctactgactcagtcaatttagcgatggttaaagctatcagcgatctgggg
catgaaatgaataagaaagtgattgctgaatcggtcgaaaataaagaaatcctcgactgc
ttagttgaattaggcgttgattttgcgcaaggatatttttttggtaaagccgttcccttg
agcgaaatcaaactcaacgaatcggatatcactgacgaacggaaataa

DBGET integrated database retrieval system