KEGG   Glaciecola nitratireducens: GNIT_0520Help
Entry
GNIT_0520         CDS       T01632                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gni  Glaciecola nitratireducens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gni00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(575598..576128)
Genome map
AA seq 176 aa AA seqDB search
MLSDIAYIGLGSNLGAPVQQLEQALKAIEMHPQMVLVASSHFYASSPMGPQNQPDYVNAV
CKIKTSLQPQELLTTLQDIENQQGRERVGDRWGPRTLDLDILLFNDLTLKTSKLTLPHYG
MQEREFVLVPLFEISPDLIMQDGRSLATWVAKCNLDGLYRIDQQASSIKQKASVTL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctgacatcgcctatattggtttaggaagcaatcttggtgcgcctgttcagcaa
cttgaacaggcattgaaagcaatcgagatgcacccccagatggtcttggttgctagctct
catttctacgctagttcaccaatgggaccgcaaaatcaacctgattatgtgaacgcggtt
tgtaaaatcaaaacttccttacaaccacaagagttgttaacgacgctacaagatatcgaa
aatcagcaaggtcgagaacgtgtaggcgaccgctggggtcctcgcacattagatttagat
atattgctgtttaatgatcttaccttgaaaactagcaaattaacgttacctcattacggt
atgcaagaaagagagtttgtgctcgtccctttattcgaaatatcccctgatctaattatg
caagatggtcgttctcttgcaacttgggttgctaaatgcaacctagatggtttgtatcgg
attgatcaacaagcgtctagtatcaaacaaaaagcaagtgtgacgttataa

DBGET integrated database retrieval system