KEGG   Glaciecola nitratireducens: GNIT_0569Help
Entry
GNIT_0569         CDS       T01632                                 

Gene name
paaG
Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00071  Fatty acid degradation
gni00280  Valine, leucine and isoleucine degradation
gni00281  Geraniol degradation
gni00310  Lysine degradation
gni00360  Phenylalanine metabolism
gni00362  Benzoate degradation
gni00380  Tryptophan metabolism
gni00410  beta-Alanine metabolism
gni00627  Aminobenzoate degradation
gni00640  Propanoate metabolism
gni00650  Butanoate metabolism
gni00903  Limonene and pinene degradation
gni00930  Caprolactam degradation
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01120  Microbial metabolism in diverse environments
gni01130  Biosynthesis of antibiotics
gni01212  Fatty acid metabolism
Module
gni_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GNIT_0569 (paaG)
   00650 Butanoate metabolism
    GNIT_0569 (paaG)
  Lipid metabolism
   00071 Fatty acid degradation
    GNIT_0569 (paaG)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GNIT_0569 (paaG)
   00310 Lysine degradation
    GNIT_0569 (paaG)
   00360 Phenylalanine metabolism
    GNIT_0569 (paaG)
   00380 Tryptophan metabolism
    GNIT_0569 (paaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GNIT_0569 (paaG)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GNIT_0569 (paaG)
   00281 Geraniol degradation
    GNIT_0569 (paaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GNIT_0569 (paaG)
   00627 Aminobenzoate degradation
    GNIT_0569 (paaG)
   00930 Caprolactam degradation
    GNIT_0569 (paaG)
Enzymes [BR:gni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GNIT_0569 (paaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 ANAPC5
Motif
Other DBs
NCBI-ProteinID: AEP28723
UniProt: G4QJR3
Position
complement(630600..631451)
Genome map
AA seq 283 aa AA seqDB search
MSSANLNSYSTISISIADEIAHIQLCRPKELNSMIDAFWTELPEAVRHIDEHALVRVIVI
SSQGKHFSAGMDLSVFQNMGASFNGEPARRAEAFRRHVLKLQDAFNALEEARMPVLVAAQ
GGIIGGAVDMISACDIRYCTDDAFFCIKETEIGMTADVGTLQRLPHLIPQGLVRELAYTG
RNMMSQEALSSGLVNQVYKDQETMLSEVMKIAKMIAGHSPMAVAGCKEMINYTRDHSVSD
SLNYIATWQSGMLQMPDVMEAMNAGQQKRKPVFENLLSKKASS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagcaaatctgaacagctacagtactatttccatcagcattgcagatgaaatt
gcgcatatacagctatgccgtccaaaagaactaaacagcatgattgacgctttctggact
gagcttcccgaagcggtaaggcatattgacgagcatgcattagtacgcgttattgttatt
tcgtcacagggaaaacacttcagtgcgggcatggatttatctgtttttcaaaatatggga
gcaagcttcaacggcgaacccgctagaagagcagaagcgtttagacgtcatgtattgaaa
ctgcaggacgctttcaacgcattagaagaagcgagaatgcctgttttagttgcggcccaa
ggcggtatcattggtggagcggttgacatgataagtgcatgcgatattcgctattgcact
gatgacgcattcttttgtatcaaggaaactgaaattggcatgaccgccgacgtcggcaca
ttgcagcgccttccgcacctcatacctcaaggcctagttagagagcttgcgtatacgggc
agaaatatgatgagtcaagaagcgctatctagcggtttagtaaaccaagtgtataaagat
caagaaaccatgctaagcgaagtgatgaaaattgcaaaaatgattgcgggtcactctcca
atggccgtcgccggctgcaaagaaatgattaactacactagagaccacagcgtaagcgat
agccttaactacatagccacttggcaaagtggtatgttacaaatgcccgacgtaatggag
gccatgaacgcagggcaacaaaagcgtaaacccgtattcgagaacttactgtctaaaaaa
gcaagttcgtaa

DBGET integrated database retrieval system