KEGG   Glaciecola nitratireducens: GNIT_0703Help
Entry
GNIT_0703         CDS       T01632                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gni  Glaciecola nitratireducens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
775470..776222
Genome map
AA seq 250 aa AA seqDB search
MNYIYNLTAATKLVAASILLLSSVLTTSAFAAQQEHAELIKRFEQKLNFKIISVADANVP
GLLQINTDTGIFYASENGEYFLSARIYRVGDEIVDETGAALQKYRLEGIKRFKDSAIEFK
SAKEKYVLNVFTDATCGYCRKLHNEMDILNDLGITVRYLAFPRQGLNSKVYSDAVSIWCS
DNPQEAMTQAKAGGNVASTSCENEVAEQYNFGKAIGVNGTPNIILPDGTVIPGYQPAQAL
LAALRAAEKA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatttataacttaacggcagcaaccaagcttgttgctgcttcaatcttgctg
ctttcctcagtgctgacgacatcagcgttcgctgctcaacaagagcatgccgagctaata
aaacgttttgagcaaaagctaaacttcaaaataatctctgtggctgacgcaaatgttcca
ggcttattgcagataaatacggacactggcattttttacgctagcgaaaacggcgaatac
tttctaagtgctcgcatttaccgcgtgggtgacgagatagtcgatgagacaggcgccgct
ttacaaaagtatcgtctggagggtatcaagcgctttaaagattcagctattgaatttaag
tctgcaaaggaaaagtatgtgttaaacgtatttaccgacgcgacgtgtggttactgtcgg
aaattgcacaatgaaatggatatcctcaatgacttgggtatcacggttcgctaccttgcg
ttcccaagacaagggcttaatagcaaagtttatagcgacgcagtctcgatttggtgttca
gacaacccgcaagaagcgatgacacaggctaaggccggtggtaacgttgctagcacatcg
tgtgaaaatgaagtagcggaacaatataattttggcaaagcaattggcgttaacggaacc
ccaaatattattttgccagacggcacagttatccccggctatcagccagctcaagctctt
ttggcagctttaagagctgcagagaaagcgtag

DBGET integrated database retrieval system