KEGG   Glaciecola nitratireducens: GNIT_0824Help
Entry
GNIT_0824         CDS       T01632                                 

Definition
delta-9 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gni  Glaciecola nitratireducens
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gni01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:gni01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(896516..897571)
Genome map
AA seq 351 aa AA seqDB search
MWALSYGFDWVEIGAAIFLFYFTGMSITAGYHRLWSHKTYSAHPIVRFILAVGGAMTLQN
SILHWSSDHRVHHKHVDIDDADPYSASKGFWFSHIGWMLREYQATRYADYSNCKDLQKDK
IVMWQHKYYLPIVLVSNFGICILLGWLNGDILGMVLLAGVTRLVLVHHVTFFINSLAHMW
GSRPFTDKNSARDNGILAFFTFGEGYHNFHHIFEYDYRNGVKWWQFDPTKWMIKGLSYVG
LTNNLRTCPEERIEKAKLEMQLKYAHDKAITLPNAEEIVVKIQHEYDVLMQRMGEYYATK
KRLVNMKKKNLQATYERLELDFKYKELKQTLAVQKQKWRTMYSFYLEPQTA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcactaagttacggatttgactgggtcgaaataggcgcagccatttttcttttt
tattttaccggtatgtcgattacagctggttatcatcgtctttggtctcacaagacatat
agcgcacatccgatagttcgcttcattttggccgtcggcggtgcaatgacattgcaaaac
agcattttacattggtcttcagatcatcgtgttcaccacaagcatgttgatattgacgac
gccgatccgtactcagcgagcaaaggcttttggttttcgcatatcggttggatgctgcgt
gaataccaagctacccgatatgcagattacagtaactgcaaagacttacaaaaagacaaa
attgtcatgtggcaacataagtattacttacctatcgtgctggtatcgaactttggtata
tgtattttgttaggttggttaaatggcgatattttaggcatggtgttactcgccggggtg
actcgacttgtactggttcaccacgtcacgttcttcataaactcactggcacacatgtgg
ggttctcgcccgttcacggacaaaaactcagcgcgcgacaatggaatattagcattcttt
acatttggcgaaggctatcataatttccatcatatatttgagtatgactatcgaaatggt
gtgaagtggtggcagtttgatccaacgaaatggatgataaaaggtttgtcatacgtgggc
ttaacaaacaatcttaggacttgccctgaagagcgtattgaaaaagctaaattagaaatg
cagcttaaatatgctcatgataaggcgataacgttgccgaacgcagaagaaattgttgtc
aaaattcaacatgaatatgatgttttaatgcagcgcatgggtgaatattatgccactaaa
aagcgtctggtaaatatgaagaagaagaatttgcaggctacatatgagcgcttagagctt
gattttaaatataaagaattgaagcaaactcttgctgttcaaaaacaaaagtggcgaaca
atgtactcattctacttagagcctcaaacggcttaa

DBGET integrated database retrieval system