KEGG   Glaciecola nitratireducens: GNIT_0846Help
Entry
GNIT_0846         CDS       T01632                                 

Definition
(GenBank) DNA polymerase III chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00230  Purine metabolism
gni00240  Pyrimidine metabolism
gni01100  Metabolic pathways
gni03030  DNA replication
gni03430  Mismatch repair
gni03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GNIT_0846
   00240 Pyrimidine metabolism
    GNIT_0846
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    GNIT_0846
   03430 Mismatch repair
    GNIT_0846
   03440 Homologous recombination
    GNIT_0846
Enzymes [BR:gni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     GNIT_0846
DNA replication proteins [BR:gni03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     GNIT_0846
DNA repair and recombination proteins [BR:gni03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     GNIT_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi PP28
Motif
Other DBs
NCBI-ProteinID: AEP28984
UniProt: G4QJU2
Position
919499..919954
Genome map
AA seq 151 aa AA seqDB search
MPIVTFYQLDENSKDAKQDILEACSQLLLETVKKRKWAAVLCTDKQQAEDVDEFVWQHPV
DSFIPHNLVGEGPKQGTPAEITWLGQSLNSRHTLINLSQSMIDNHRQYQHIIDFVPVEET
QKQQARERYKQYKLAGCTMQFTPANQINESN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcgtgactttttatcaattggacgaaaatagcaaagatgcaaagcaggatatc
ttagaagcctgctcccaattgttattggaaacagtaaagaaacgcaaatgggcggcggta
ttgtgcactgacaagcagcaggctgaggatgtcgacgaattcgtttggcagcacccggtc
gatagtttcatcccgcataatttggtgggagagggccctaagcaaggaacgcctgctgaa
attacgtggcttggtcaaagtctaaatagccgtcatacgctcattaatttatcacaaagc
atgatagacaatcatcgccagtaccaacacattattgattttgtgcctgttgaagaaact
caaaagcagcaagcacgagaaagatacaagcagtataaattagccgggtgcactatgcag
ttcacgccagctaatcaaataaacgagagtaattaa

DBGET integrated database retrieval system