KEGG   Glaciecola nitratireducens: GNIT_0990Help
Entry
GNIT_0990         CDS       T01632                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gni  Glaciecola nitratireducens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GNIT_0990
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GNIT_0990
   00630 Glyoxylate and dicarboxylate metabolism
    GNIT_0990
Enzymes [BR:gni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GNIT_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1080623..1082875)
Genome map
AA seq 750 aa AA seqDB search
MSTVSTKTTSSPGANGISASAERYVTKGKLSVASELLNFIESSALPNSQTDALAFWQGFE
KVLESLMPLNKALLNERETLQKQIDDFHRVDANAPANEYKSFLSTIGYLQAPPIPKSIET
QNVDAEIATMAGPQLVVPINNARYALNAVNARWGSLYDALYGTDVISDEGGAEAKGAYNP
ARGNKVILKAREYLDTIAPLNVGSHVGSQDYQLRDAGLSITLADGSETTLQDPSQLIGFQ
GEIESPTAILVSHNGLHAEIQFDNSHPIGKTDPAGMKDIVLEAAITTIMDCEDSVAAVDA
EDKTLVYQNWLGLMQGNLRIQLDKGDKTFTRSMNPDREYRSLQNEKITLSGRSLMFIRNV
GHLMTNSAILFEGEEIPEGIMDAMITSLIAKHDLLNNSPFKNAKENSIYIVKPKMHGPDE
VAFTNRLFSSVEQVLGLAKNTIKIGIMDEERRTSLNLGACIQAANERVVFINTGFLDRTG
DEIHTSMLKGAFAPKAEIKTRPWLNAYELANVATGLNFGLSGRAQIGKGMWPIPDQMANM
MAVKIGHPKTGANTAWVPSPTAATLHALHYHQIDVFEQQRNILSDNKNAHLDYIDTILEI
PLMEKGAKLSPQEVTNELDNNVQGILGYVVRWVHQGIGCSKVPDINGVGLMEDRATLRIS
SQHIANWLEHGLVTAEQVNESLQRMAALVDSQNESDAEYIPMLPDLANSIGFQAAKDLIF
LGKEQPSGYTEPLLHARRREMKAKLKDAAS
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggtttcaacaaagacaacaagttcacctggtgcaaatggcatcagtgccagc
gcagaaagatacgtaacaaaaggcaaactgtcggtcgccagcgaactactcaatttcatc
gagtctagcgccttaccaaattcccaaactgacgctctcgcgttttggcaaggctttgaa
aaagtcctcgaaagcttaatgccactcaataaagcactattgaacgaacgtgaaacttta
caaaaacaaattgacgactttcaccgcgtcgatgcaaacgctcccgcaaatgaatacaaa
tcctttttaagcacaataggctatttgcaagcacctccgattcctaaatcaattgaaact
caaaacgtagacgccgaaattgcgactatggcaggaccgcaacttgttgtcccaatcaat
aacgcgagatatgcattgaatgctgttaatgcccgctggggaagtttatacgacgcactc
tatggcactgacgttatttcagatgaaggtggcgccgaagctaaaggggcatacaaccct
gcccgtggtaataaagttatcctaaaagcacgagaatacttggatactattgccccttta
aatgtaggcagccacgtcgggagtcaagactatcagctacgtgacgctggtttatcgatt
accttggctgatggcagcgaaacaacgttgcaagacccgtctcaactaattggttttcag
ggcgaaatagaaagcccaacagcaattctagtaagtcataacggcttacatgctgaaatt
cagtttgataattcacatcccattggcaaaacagatcccgcaggtatgaaagacattgtt
cttgaggcagcgataaccacgattatggactgtgaagacagtgttgccgcagttgatgcc
gaggacaagaccttagtttatcaaaactggttgggcttgatgcaaggcaatttacgcatt
cagcttgataaaggggataaaacttttacccgcagcatgaacccagatcgtgagtatcgt
tctctgcaaaatgaaaagattacgctttctggtagaagtctgatgtttatccgcaacgtt
gggcatcttatgacaaacagtgcgattttatttgaaggggaagaaatcccagaagggata
atggacgcgatgattacatcgcttatcgccaagcatgacctacttaataatagccctttt
aaaaatgcaaaagaaaacagtatttatatcgtaaaaccaaaaatgcatggtcctgatgaa
gtcgccttcacaaaccgactattcagcagcgtggaacaagtacttggtttagcaaagaat
acgataaaaataggcattatggatgaagaacgcagaacgagcctcaatttaggtgcgtgt
attcaagctgcaaacgagcgagtggttttcatcaacacaggctttttagatcgcactggc
gatgaaattcatacatctatgctgaaaggtgcttttgcaccaaaagcagaaataaaaacg
cgcccttggttgaatgcctacgaattagcgaatgtcgctacggggctaaattttgggcta
tctggtcgcgcgcaaattggtaaaggcatgtggcctattcctgatcaaatggctaacatg
atggcggtcaaaatcgggcatccgaaaacgggcgcaaataccgcttgggttccgtctcca
acggcagcaactttgcacgcgctgcattatcatcaaattgacgtctttgaacagcagaga
aatatacttagcgataataaaaatgcccatttggattatatcgataccattctagaaatc
ccgctcatggaaaaaggtgcaaaactaagtccgcaagaagtcactaacgaactcgacaat
aatgttcagggtattttaggctacgttgtgcgctgggtacatcaaggcattggctgttct
aaagtgcccgatattaatggcgtcggcctcatggaagacagagcgacgttgagaattagc
agtcagcatattgcgaactggcttgaacacgggcttgtaactgcggagcaagtaaatgag
tctttgcaacgaatggctgctttggttgatagtcaaaatgaaagtgatgcagaatacatt
ccgatgcttccagacttagcgaattcaatcggttttcaagccgctaaagaccttatcttc
ttaggcaaagaacaaccatctggttacactgagccgctgttgcatgctcgccgcagagaa
atgaaggcaaagcttaaggacgctgctagttag

DBGET integrated database retrieval system