KEGG   Glaciecola nitratireducens: GNIT_1187Help
Entry
GNIT_1187         CDS       T01632                                 

Gene name
cysQ
Definition
PAP (3,5 adenosine diphosphate) 3 phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gni  Glaciecola nitratireducens
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gni00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1283179..1283976)
Genome map
AA seq 265 aa AA seqDB search
MTSFDLTPELAEKVKQIAVQAGKKIMEIYDKDFTIYDKSDSSPLTDADLAAHHHIVDGLK
AISPLPILSEESADIPWSTRKTWVRYWLVDPLDGTKEFIKKNGEFTVNIALIEYGVPTFG
VVHAPAIDKTYVGQEDVGAYSEVNGTQSPIKAKKHTVGETWKIVGSRSHQSSEINKILDA
LGGENELVAMGSSLKLCLVASGEAHMYPRVGPTCEWDTGAAHAVAIAAGAKVTVLDVENP
MDADASPLRYNQKDSVLNPYFLVSC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacgagttttgatttaacaccagaacttgccgaaaaggtaaagcagattgcggtgcaa
gccggcaagaagatcatggaaatctatgataaagactttaccatttacgacaagtcagat
tccagcccgctgaccgacgccgatttggcggcacatcatcacattgttgacggcttaaaa
gcgatatcacccttgcctattttatctgaagagtcggcagacataccttggtctacgcgt
aaaacgtgggttaggtattggcttgtcgacccattagatggcactaaagagttcattaaa
aagaacggcgagtttacggtaaatattgctttaatcgagtatggagtgcccacctttggt
gtggtacacgcacccgcgattgataaaacttacgttggccaagaggatgttggcgcctac
agtgaagtgaatggtactcaatccccaataaaagcaaaaaaacacactgttggcgagaca
tggaaaattgttggaagtcgctctcatcagagctctgaaataaacaaaatcctcgacgct
cttggtggcgaaaatgaattagtcgcgatgggcagttctttgaagctttgcctagtcgcc
agtggagaagcccatatgtatccgcgcgtgggacctacctgcgaatgggatactggtgca
gctcacgctgttgctattgccgctggggcaaaggtaaccgtcctagatgttgaaaatcca
atggacgcagacgcatcgccacttcgatacaaccaaaaagactcagtcttaaacccctat
ttcttggtaagttgctaa

DBGET integrated database retrieval system