KEGG   Glaciecola nitratireducens: GNIT_1206Help
Entry
GNIT_1206         CDS       T01632                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gni  Glaciecola nitratireducens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GNIT_1206 (fadJ)
   01212 Fatty acid metabolism
    GNIT_1206 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GNIT_1206 (fadJ)
   00650 Butanoate metabolism
    GNIT_1206 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    GNIT_1206 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    GNIT_1206 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GNIT_1206 (fadJ)
   00310 Lysine degradation
    GNIT_1206 (fadJ)
   00380 Tryptophan metabolism
    GNIT_1206 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GNIT_1206 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GNIT_1206 (fadJ)
   00281 Geraniol degradation
    GNIT_1206 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    GNIT_1206 (fadJ)
Enzymes [BR:gni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GNIT_1206 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GNIT_1206 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     GNIT_1206 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1302937..1305045
Genome map
AA seq 702 aa AA seqDB search
MGAFTLQKREDGIAILTMDVPGDSMNTLKADFGDEVTAILDEIENDDAIRGVVVASGKKD
SFVAGADVTMLAACNDADEAEELSTSGQRLFDRMQDMKKTFVAAIHGPALGGGLELALAC
HYRVCSDSPKTQLGLPEVQLGLLPGSGGTQRLPALIGIQQAMKMMLTGAPVRAKQAKKYG
IVDDMVPQSILLDVAIEMANKKISKRVLKKDMMAKALENTSFGRNILFKKAREQTLSKTL
GNYPAPMYIIDCIEAGTNDSRKGYATEARLFGQLVMTPESKQLREIFFATTDMKKESGVD
GVAAVKVKKIGVLGGGLMGGGIAFVTATKAKVPARIKDINPNGIAGAIRYSYDILNKKVK
KRFMLKTEMQKQLSLLSGCLDYSGYQNNDMVIEAVFEDVKLKQKMVADIEEHCNEHTVFA
SNTSSIPIAEIAAEAKRPENVVGLHYFSPVDKMPLAEVIPHAKTSDQTISTTVEFAKRQG
KTPIVVKDGAGFYVNRILAPYVSEAGFMAIEGQPLDSIDKALMKFGFPVGPFKLLDEVGI
DVGTKIIPILKGQFGERFNAPEAFDKLLENDRKGKKNKSGFYDYDAKNAGKHIDDSVYRL
LGITPEKKFSADTVVERCVLMMLNEAALCLQEEVIRNPRDGDIGAIFGIGFPPFLGGPFR
YMDTLGIEHVVSRLEHYAETYSEKYQPAEILLTMCKEGKSFY
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcatttaccttacaaaaacgagaagacggtattgccattttaactatggatgta
ccgggcgacagcatgaatacgctgaaagctgactttggcgatgaagttactgccatattg
gacgaaatcgaaaacgatgatgccattcgcggtgtcgtagttgctagtggtaaaaaagat
tcattcgtggcgggtgccgatgtcaccatgcttgcggcctgcaatgatgcagacgaagct
gaagaattgtctacttctggtcaaagactgtttgatcgcatgcaggatatgaaaaagacc
tttgttgctgctattcacggccctgctttaggtggtggcttagagcttgcgctcgcttgt
cattatcgcgtttgttctgatagcccgaaaacacagctgggtttgcctgaagtgcagctt
ggtctattaccaggaagcggcggcacacaaagattgccagcactcattggtattcaacaa
gcaatgaagatgatgctgactggtgcgccagtgcgcgcaaaacaagccaagaaatatggc
attgttgacgacatggttccgcaatcaatcctacttgatgttgcgattgaaatggcgaac
aaaaaaatcagtaagcgtgtgttgaaaaaagacatgatggcaaaagcgctagagaatact
tctttcggacgcaacatattgttcaaaaaggcgcgtgaacagacgctgtctaaaacatta
gggaattatcccgcacctatgtacattattgattgtatagaagcaggcacaaatgattca
cgcaaaggctacgctactgaagcccgcttatttgggcagctagtgatgacaccagaatca
aaacaactgcgtgaaattttctttgcgacaaccgacatgaagaaagagtcaggcgttgat
ggtgttgcagctgttaaagtgaaaaagattggcgtgctaggcggtggattaatgggtggt
ggaattgcctttgtaacggcgactaaagcaaaagtacctgcacgcatcaaagacatcaat
ccaaacggcattgccggcgcaatacgctacagctatgacattttgaataagaaagtgaaa
aaacgtttcatgttaaaaactgaaatgcaaaaacagctttccctgttaagcggctgtttg
gattacagtggttatcaaaacaatgatatggtcatagaagcggtattcgaagacgtcaaa
ttgaagcaaaagatggttgctgatattgaggaacactgtaatgaacatactgtttttgca
tcgaatacgtcgtcaattccaattgctgagattgcagccgaagcgaagcgtcctgaaaat
gtggtgggtttacattacttttcaccagtagataaaatgcctctagctgaagttattcct
cacgctaaaacatcagatcagactatctcaactaccgttgaatttgcaaagcgtcaaggt
aaaacgcctatcgtggtaaaagatggcgcaggcttctatgtgaaccgtattttagcgcct
tatgtgagtgaagcgggctttatggcaatagagggacaaccacttgactctattgacaaa
gcgttgatgaagtttggattcccagtagggccgtttaaactactcgacgaagtaggaatt
gatgtcggcactaaaattattccaattttgaaagggcagtttggagagcgttttaatgca
ccagaagcctttgataaattactcgagaatgatcgtaagggtaagaaaaataagtctggt
ttttatgattatgatgctaaaaatgctggtaaacacatcgatgattccgtttacagatta
ttgggcataacaccggagaagaagttttcagccgacacggtggtagaacgctgtgtgctc
atgatgctcaacgaagcagcactttgtttgcaagaagaagtaattagaaacccgcgagat
ggtgacatcggcgctatttttggtattggcttcccgccatttttaggcggacctttccgt
tatatggacaccttgggaattgaacatgtggttagccgtttagagcattatgccgaaact
tactcagagaagtatcagcccgctgaaatattgttaacaatgtgtaaagaaggtaaatct
ttttactaa

DBGET integrated database retrieval system