KEGG   Glaciecola nitratireducens: GNIT_1358Help
Entry
GNIT_1358         CDS       T01632                                 

Gene name
glpK
Definition
carbohydrate kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gni  Glaciecola nitratireducens
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gni00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1477565..1479055)
Genome map
AA seq 496 aa AA seqDB search
MSTKSGILSIDQGTTSTRAIVFALDGTKIASAQKEFTQFYPYNGWVEHDPEEIWKTTVET
CKSALHQAQEKGVRVVGIGITNQRETTLVWNRETGKPIYNAIVWQDRRTAAFCNSIKEQE
ELVASKTGLLLDPYFSASKIKWLLDEIDGARELANQGKLAFGTIDSFLIWRLTGGISHVT
DMTNASRTNLYNIHTLCWDEALLSLFDIPSSVLPKVLESADDFGHTKASLFGRAIPIAGV
AGDQQAALFGQCCFSQGDLKSTYGTGCFALLNTGSKALQSKHKLLTTIGYTINGETTYAL
EGSIFTAGANIQWLRDGIGVITEAKESQALAESLDYDHGVFLVPGFAGLGAPQWDPEARA
SLYGMTRDTSQAHFARAALEAVCYQTYDLQQAMASDGICSSKVLVDGGMVANDWLCQFLS
DILQVEIERPENMETTAIGAAYLAGLQLGLYRDLSDIASHKKIAKRFTPSIDKDVRQKLL
TKWQKAVDSTLAFSRD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaaatcaggaattctttcgatagatcagggaactacctctactcgagcaata
gtttttgctttggatggcactaaaatagccagcgcccaaaaagaatttacacagttttac
ccctacaacggctgggtcgaacacgatcctgaagaaatctggaaaacaacggttgaaaca
tgtaaatcggcattacatcaagcccaagaaaaaggggtcagagttgttggtatcggcatt
acaaatcaacgtgaaaccacgctagtgtggaatagagaaacaggcaaaccgatatacaac
gcaatcgtttggcaagaccgccgtactgctgctttttgcaatagcataaaagaacaagaa
gagcttgttgcaagcaaaaccggtttattgttagacccctatttctcggcttccaaaata
aaatggttgctagatgaaatagacggtgcgagggagcttgccaatcaaggcaaattagct
tttggcactattgatagctttttaatctggcgtcttaccggtggtataagtcatgttaca
gatatgaccaatgcatcacgcaccaatctgtataacattcacactttatgttgggatgaa
gcgttgctttccctctttgatatcccctcttcagtgctgccaaaagtactcgaaagtgcg
gatgatttcggccatacgaaagcaagtttatttggccgtgcgatacctatagctggtgtt
gcgggcgaccaacaagctgcattgtttggccagtgttgtttttcacaaggtgatttaaag
tctacctacggcacagggtgttttgcattgctaaatacgggtagcaaggctttacaatca
aagcacaaactattgacgactattggctacactataaatggtgagacaacttacgcttta
gaaggctctatatttaccgcaggggctaacattcaatggttaagagatggtatcggcgtt
attaccgaggcaaaagagagccaagcgttagcagaatcgctcgactatgatcacggcgta
tttttagtacccggttttgctggtttgggagcacctcagtgggatcctgaggctcgagca
agcctatatggcatgacgagagacacatcgcaggctcatttcgctcgcgctgcgctagag
gctgtgtgttatcaaacctatgacctgcagcaagccatggcgagtgatggcatctgctca
tctaaagttctagttgatggtggtatggtggcaaatgactggttatgccagtttttatcc
gatattttacaagttgaaatagaacgccccgaaaatatggaaacaacagcaattggcgcg
gcctacttagcaggattacaacttggtctgtatagggatctaagcgatattgcgtcgcat
aaaaaaattgcaaaacgttttacgccgagtatcgataaagacgtacggcaaaaactattg
acgaaatggcaaaaagcggtggattctactctcgcatttagtcgcgactag

DBGET integrated database retrieval system