KEGG   Glaciecola nitratireducens: GNIT_1432Help
Entry
GNIT_1432         CDS       T01632                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00260  Glycine, serine and threonine metabolism
gni00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01130  Biosynthesis of antibiotics
gni01230  Biosynthesis of amino acids
Module
gni_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GNIT_1432 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GNIT_1432 (trpA)
Enzymes [BR:gni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GNIT_1432 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AEP29551
UniProt: G4QL80
Position
complement(1549919..1550731)
Genome map
AA seq 270 aa AA seqDB search
MSTTRYADMFASLKAKNEGAFVPFVMVGDPDHETSLAIIDQLVKSGADALELGIPYSDPI
ADGPTIQKASIRALGSGIRPQSCFEILTQIRKQHPTIPIGLLLYSNLVLANGIDNFYERA
AAAGVDSILIADVPLREADRFITIAKQHDIQQILIAPPNASNETLEAIGEKSDGYTYLLG
RAGVTGAETAVEIPAAELIAKLTQYKVAPPLLGFGISTPEQVANAIQSGAAGAISGSATV
NIIESNLKDKDKMLAELGSFVAKMKAATIL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacacgttatgcggatatgtttgccagcctaaaagcaaaaaatgaaggcgcg
tttgttccgttcgtcatggttggcgacccggaccacgaaacatccctagccatcattgac
caattagtcaaaagcggtgccgatgcattggaactaggtatcccctactctgacccgatt
gccgatggcccaacgatacaaaaagccagtattagagccttgggcagcggcataagacca
cagagttgctttgagatactgactcaaatacgcaaacaacatccaacgattcctatcggc
ctattgctatacagtaacttagtattagccaacggtatcgataacttttatgagagagct
gctgcagcaggtgttgattcaatccttattgcagatgtaccgctgagagaggcagaccgc
tttatcaccatcgcaaaacagcatgacattcagcaaatattgattgcgccacctaacgca
agcaatgaaacattggaagccatcggggagaaatctgacggctacacctatctattaggt
agagccggtgtaacgggtgctgaaactgcagtagaaattccagcggctgaactcattgca
aagttaactcagtataaagttgctccgccattattgggcttcggtattagtacgccggaa
caggtagccaatgcgattcagtcaggtgctgcaggagcaatttcaggctctgccactgtt
aatattatcgagtcaaacttaaaagacaaagataaaatgctagcagaattaggcagtttt
gtagccaaaatgaaagcagctaccatactataa

DBGET integrated database retrieval system