KEGG   Glaciecola nitratireducens: GNIT_1433Help
Entry
GNIT_1433         CDS       T01632                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta protein
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00260  Glycine, serine and threonine metabolism
gni00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01130  Biosynthesis of antibiotics
gni01230  Biosynthesis of amino acids
Module
gni_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GNIT_1433 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GNIT_1433 (trpB)
Enzymes [BR:gni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GNIT_1433 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEP29552
UniProt: G4QL81
Position
complement(1550728..1551909)
Genome map
AA seq 393 aa AA seqDB search
MNKLESKFGDFGGMYVPELLIPALDQLEQAFLDAKDDPSFQKEFMGLLKDYAGRPTAMTL
TRNIVTNPLVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKTEVIAETGAGQHGVATAL
ACALLGLKARIYMGAKDVERQSPNVFRMRLMGAEVIPVDSGSGTLKDAVNEAMRDWSANY
DKAHYLLGTAAGPHPFPTIVREYHRMIGEETRAQIMEKEGRLPDAVVACVGGGSNAIGMF
ADFIDEPSVRLVGVEPAGKGIHTKEHGATIVTGTKGILHGAYTYIMQDEDGQIEESYSVS
AGLDYPAVGPQHAFLAETGRAEYHAITDVEALNAFQLLAKKEGIIPALEPAHALAHALNM
ADEATEETIIVLNLSGRGDKDLAHVISILGDDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattggaaagtaaatttggtgattttggcggtatgtacgtcccagaattgctc
attcctgccctcgaccaattagagcaggcatttttagatgcgaaagatgacccaagcttt
caaaaagaatttatgggtttattgaaagattatgcaggtcgtcctactgcgatgacactg
acccgcaacatcgtgaccaacccattggtaaagctgtatttaaaacgtgaagatttattg
cacggcggtgcacataaaaccaaccaagtattaggtcaggccttattgacaaagcgcatg
ggaaaaactgaggttattgctgaaacgggcgctggccagcatggcgtagcaactgcttta
gcatgcgctctattgggattaaaagcacgtatctacatgggtgcgaaagacgttgaaaga
cagtcgcccaatgtattcagaatgcgcttaatgggtgctgaagttattcctgttgactct
ggttctggtaccttgaaggatgctgttaacgaagcgatgcgcgactggtctgcaaactac
gacaaggctcattatttactcggcaccgctgctggtccacatccattccctaccatcgtg
cgtgaatatcaccgcatgattggtgaagaaactcgtgcacaaattatggaaaaagaaggt
cgcttacctgatgccgttgtcgcctgtgttggcggtggctccaatgcgataggcatgttt
gctgacttcattgatgaaccgtctgttcgcttagtcggcgttgagcctgcaggtaaaggc
attcataccaaagagcatggcgcaactatcgtaaccggtacaaaaggtattttacacggc
gcttacacttatattatgcaagacgaagatggtcagattgaagagtcttattcagtatct
gctggtttggattaccctgcggtaggtccacaacacgcgtttctagctgaaacggggcgc
gctgaatatcacgctattactgatgttgaagcattaaacgcatttcaattattggctaaa
aaagaaggtattattcctgcattggaaccagctcatgcccttgctcacgcgcttaatatg
gcagatgaagcaactgaagaaaccattatcgtactcaatttgtcaggacgcggagacaaa
gatcttgcgcacgtcattagtatcttaggagacgatctatga

DBGET integrated database retrieval system