KEGG   Glaciecola nitratireducens: GNIT_1674Help
Entry
GNIT_1674         CDS       T01632                                 

Gene name
nagZ
Definition
glycoside hydrolase family protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gni  Glaciecola nitratireducens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GNIT_1674 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    GNIT_1674 (nagZ)
Enzymes [BR:gni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GNIT_1674 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1848495..1849517
Genome map
AA seq 340 aa AA seqDB search
MSAVILDVHSFELSSVEREMLQHPLCGGVILFSRNYAEKRQLSELIKDIRRTVNKPFLIS
VDHEGGRVQRFRDGFTQIPAMANIEKFEKSHSAQLALAQSMGFCMAHELLQLDIDISFAP
VLDLNGVSEVIGSRAFSSDPDQVILLSGAYIDGMHKAGMKSTGKHFPGHGSVTEDSHIAM
PVDNRSFEDIQQQDMRVFQQLIKAKKVDAVMPAHVIYPQVDDKPAGFSEIWIQQILRKQL
GFEGVVFSDDLSMQAASVAGSVTERAEQAIEAGCDMVLVCNSPSQAEKVLDGLSQLKVYS
QRWRELLQKNSQQRDVDKHQRDATYLSSSQLINRLNEQFS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcggttattcttgatgtgcacagttttgaactcagttcagttgaacgagaaatg
ttacagcatccactatgtggaggagtgatattatttagtcgcaattatgctgaaaagcga
caattgtcagaattgattaaagacataagacgaactgtgaataagcctttcctcatttct
gttgatcatgaaggtggtcgagttcagcgtttcagagacggatttacgcaaattccggca
atggcgaatattgaaaagtttgaaaaatcgcacagtgctcagcttgccttggcacaaagc
atgggcttttgcatggctcatgaactattgcagttggatatcgacattagctttgcaccg
gtgctagaccttaatggtgtaagtgaagttattggtagtagagcattttcatcggatcca
gaccaagtaattttgttaagtggcgcttatatagacggaatgcataaggcgggtatgaaa
agtacgggcaaacattttccaggtcacggctccgtcacagaagacagtcatattgcgatg
ccagttgataatcgcagttttgaagacattcaacagcaagatatgcgagtgtttcagcaa
cttattaaagcgaaaaaagtagatgcagttatgcctgcgcatgtcatatatcctcaagta
gacgataaacctgcaggcttttctgaaatttggatacagcaaattttacgtaagcaactc
ggttttgaaggcgtcgtattttcagatgacttgtcaatgcaggcagcaagtgttgctgga
agtgtgaccgagcgggcagagcaagcaattgaagctggttgtgatatggttttagtatgt
aattcgccctcacaggcggagaaagtgctagatggattgagtcaacttaaggtctatagt
caacgatggcgtgaactgttgcaaaaaaacagccagcagcgcgacgtagataagcatcaa
cgagacgccacttacctttcgagtagtcagctcattaatcgcctaaatgagcagttttct
taa

DBGET integrated database retrieval system