KEGG   Glaciecola nitratireducens: GNIT_1674Help
Entry
GNIT_1674         CDS       T01632                                 

Gene name
nagZ
Definition
glycoside hydrolase family protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gni  Glaciecola nitratireducens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gni00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:gni00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1848495..1849517
Genome map
AA seq 340 aa AA seqDB search
MSAVILDVHSFELSSVEREMLQHPLCGGVILFSRNYAEKRQLSELIKDIRRTVNKPFLIS
VDHEGGRVQRFRDGFTQIPAMANIEKFEKSHSAQLALAQSMGFCMAHELLQLDIDISFAP
VLDLNGVSEVIGSRAFSSDPDQVILLSGAYIDGMHKAGMKSTGKHFPGHGSVTEDSHIAM
PVDNRSFEDIQQQDMRVFQQLIKAKKVDAVMPAHVIYPQVDDKPAGFSEIWIQQILRKQL
GFEGVVFSDDLSMQAASVAGSVTERAEQAIEAGCDMVLVCNSPSQAEKVLDGLSQLKVYS
QRWRELLQKNSQQRDVDKHQRDATYLSSSQLINRLNEQFS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcggttattcttgatgtgcacagttttgaactcagttcagttgaacgagaaatg
ttacagcatccactatgtggaggagtgatattatttagtcgcaattatgctgaaaagcga
caattgtcagaattgattaaagacataagacgaactgtgaataagcctttcctcatttct
gttgatcatgaaggtggtcgagttcagcgtttcagagacggatttacgcaaattccggca
atggcgaatattgaaaagtttgaaaaatcgcacagtgctcagcttgccttggcacaaagc
atgggcttttgcatggctcatgaactattgcagttggatatcgacattagctttgcaccg
gtgctagaccttaatggtgtaagtgaagttattggtagtagagcattttcatcggatcca
gaccaagtaattttgttaagtggcgcttatatagacggaatgcataaggcgggtatgaaa
agtacgggcaaacattttccaggtcacggctccgtcacagaagacagtcatattgcgatg
ccagttgataatcgcagttttgaagacattcaacagcaagatatgcgagtgtttcagcaa
cttattaaagcgaaaaaagtagatgcagttatgcctgcgcatgtcatatatcctcaagta
gacgataaacctgcaggcttttctgaaatttggatacagcaaattttacgtaagcaactc
ggttttgaaggcgtcgtattttcagatgacttgtcaatgcaggcagcaagtgttgctgga
agtgtgaccgagcgggcagagcaagcaattgaagctggttgtgatatggttttagtatgt
aattcgccctcacaggcggagaaagtgctagatggattgagtcaacttaaggtctatagt
caacgatggcgtgaactgttgcaaaaaaacagccagcagcgcgacgtagataagcatcaa
cgagacgccacttacctttcgagtagtcagctcattaatcgcctaaatgagcagttttct
taa

DBGET integrated database retrieval system