KEGG   Glaciecola nitratireducens: GNIT_1746Help
Entry
GNIT_1746         CDS       T01632                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
gni  Glaciecola nitratireducens
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gni00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1929753..1931537)
Genome map
AA seq 594 aa AA seqDB search
MPNHFVQFTAKVKHHLEVIYHDILTPSEIEILVPKLQHSIGVTGNDNCHYPTPHKNRWDE
SDIVMITYGDSIVENTEGVEFGFSQKPLKTLRRFINEYCDSIISHVHILPYFPYSSDDGF
SIIDYSIVNQSLGDWKDIEAISKEYGLMTDVVINHCSARSQWFENFSKQEGIGSDYFFTA
SPDDDLSMVVRPRTSDLLKVVETPNGPKHVWCTFSHDQVDFDFRNPNVLIAFIDIIRLYL
DKGTKVFRLDAIAFLWKVPGSPSINLPETHEVVRLLRTLIEHTAPEVIIITETNIPNREN
LTYFGNANEAHAIYNFSLPPLLINTLVTGNCAYLKSWMMSMPPAQNGTTYFNFIASHDGV
GLRPAEGLLDEQEIAELANCMQNFGGKVSWRKTDNGQQKPYEMNIALIDALKGTIKGPDQ
YQFQRFICAHAIMLGLEGIPGIYIHSLLGTPNDEEKVKNTGHNRGINRHRWDFAELISEL
EDKQSLHANVLSALSLLIRIRRSQPAFHPNAVQFTLQLGTEIFGYWRQSIDRKQSIFCIS
NVTDIEQKVRLSDINLIENSLWHDLIAEKTINQTTEFLCLAPYQTMWISNKATG
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatcattttgttcaatttaccgctaaagtaaaacatcatttggaagtaatttat
cacgatattttaactccctctgaaatcgaaatactagtgcctaaattgcagcacagtatt
ggcgtcacgggcaacgataattgtcattacccaacgccgcataaaaacagatgggatgaa
tcagacatcgtcatgatcacctacggtgacagtattgttgagaacaccgaaggcgttgaa
tttggttttagccagaaaccgttgaagacacttcggcgcttcattaatgagtattgtgac
tcgattataagtcacgtgcacatattgccctactttccctatagttccgacgatggcttt
tctattattgactactctatcgttaaccaaagcttaggtgactggaaagatatcgaagct
atttcaaaagaatatggtcttatgaccgatgttgtcatcaatcattgttcagcgcgaagc
cagtggttcgaaaattttagcaaacaagaaggtattggtagcgactatttctttactgcg
tcaccggatgacgatcttagtatggtagtgcgtcctagaacttcagacctgttgaaagta
gttgaaacaccgaatgggccaaagcatgtatggtgcacattcagtcacgatcaggtcgat
tttgattttagaaatccaaatgtgcttatcgctttcatcgatatcattcgtttatattta
gataaaggaacaaaagtttttcgtttggacgccatcgcatttttatggaaagtacccggt
agcccaagtatcaatttgcccgaaactcatgaagttgttcgacttttaagaacacttatt
gagcacaccgcgccagaagttattatcatcactgaaactaacattccgaatagagaaaac
ctgacctacttcggtaatgcaaatgaagcccatgctatttataatttctcattgccccct
cttctcatcaatacgctggtaaccggcaattgtgcatatttgaaaagttggatgatgagt
atgccgccggcacaaaatggtacaacgtactttaattttattgcctcgcacgacggcgtt
ggcttgcgacctgctgaaggattgctggatgaacaggaaattgctgaacttgcaaattgt
atgcaaaactttggcggcaaagtttcttggcgaaagacagacaatggtcaacaaaaacct
tatgagatgaatattgcgttgattgacgcattaaagggcacaataaaaggccccgatcag
tatcaatttcagcgttttatttgtgcgcatgcaattatgctcggactagaagggataccg
ggtatttatattcactctttactaggtacacctaatgatgaagagaaagttaaaaatact
gggcataaccgcggcattaatcgtcaccgctgggacttcgctgagcttatctctgaatta
gaggacaaacaaagcctacatgcgaatgtgttgtctgctttgtctctgcttataagaata
cgacgttctcagcctgcatttcacccaaacgcggtccaatttaccctgcagttagggaca
gaaatatttggttattggaggcaaagtattgaccgaaaacaaagcatattttgtatatct
aacgtaaccgatatagagcaaaaggttagactgtcagatatcaacctgattgaaaatagt
ttatggcatgatctgatagctgaaaaaacaattaatcagacaactgagtttttgtgtcta
gcaccctaccagacaatgtggatttcaaataaagccacaggttaa

DBGET integrated database retrieval system