KEGG   Glaciecola nitratireducens: GNIT_1847Help
Entry
GNIT_1847         CDS       T01632                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00010  Glycolysis / Gluconeogenesis
gni00030  Pentose phosphate pathway
gni00051  Fructose and mannose metabolism
gni00052  Galactose metabolism
gni00680  Methane metabolism
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01120  Microbial metabolism in diverse environments
gni01130  Biosynthesis of antibiotics
gni01200  Carbon metabolism
gni01230  Biosynthesis of amino acids
gni03018  RNA degradation
Module
gni_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GNIT_1847
   00030 Pentose phosphate pathway
    GNIT_1847
   00051 Fructose and mannose metabolism
    GNIT_1847
   00052 Galactose metabolism
    GNIT_1847
  Energy metabolism
   00680 Methane metabolism
    GNIT_1847
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GNIT_1847
Enzymes [BR:gni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GNIT_1847
Protein phosphatases and associated proteins [BR:gni01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GNIT_1847
Messenger RNA biogenesis [BR:gni03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GNIT_1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEP29956
UniProt: G4QHH0
Position
2026702..2027670
Genome map
AA seq 322 aa AA seqDB search
MTKIQHIGIFTSGGDAPGMNAALFAVVKTAETLGIKVSGIRRGFEGLIDDDLIPLQSQQL
QKQMHLGGTILKTARSERFKSKLGQEKSVQTIKDNKLDALIAIGGDGTFRGMLSLSSISN
IPFIGIPGTIDNDIAGTDYTLGFDSAVNTAIKCIDNIRDTAESHNRVFLVEVMGRDSGYI
SIYSGLSCGADSILIPESAQDFTYLLEKIKNYSSEDAFIVVVAEGDEVSVEEVSSKIRSV
NTDIDLRIAKLGHIQRGGNPSAQDRMLGIRLGVLATKALFQGESNKMAGVRNNRPTLSAF
ESRVKEHIIDAELQALLTLFCK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagatacagcatataggtatttttacttcaggcggtgacgctcccggtatgaat
gcggcactatttgcagtggtaaaaaccgctgagactctcggcataaaagtgagtggtata
cgaagagggtttgaaggtttgattgatgatgatctaataccgcttcaatctcagcaattg
caaaaacaaatgcacctaggcggcactattcttaaaacagcccgtagtgagcgtttcaag
tctaaactgggacaagaaaagtctgtgcaaacaattaaagacaataaacttgatgcgctt
attgctattggtggtgatggtacttttcgaggtatgttatcgctatcaagtatcagcaat
attccctttataggcatccccggtacaatagataacgacatagcgggcactgattatacg
ctcgggtttgattcagcggtgaatacagcgataaagtgtattgataatattcgggatact
gctgaatctcataatagagtgtttttagtcgaggtgatgggacgcgactctggctatatt
agtatttattcaggtcttagttgtggtgcggattccatactgatacccgaaagtgcccaa
gatttcacctatcttttagagaaaattaagaattacagcagcgaagatgcatttatcgtg
gtggttgcggaaggagatgaggtaagtgttgaagaagtttcttcaaaaatacggagcgta
aacactgatatagatttgcgaatagctaagctcggtcatattcagcgaggtggaaaccct
tctgctcaagatcgtatgttgggtataaggctaggtgtgctcgcaactaaagcgctcttt
caaggtgaatcaaataaaatggcgggggtccgcaataataggccgacattaagcgcgttt
gagtctcgagtgaaagaacatataattgacgctgagctacaagctcttttaacattattt
tgtaagtaa

DBGET integrated database retrieval system