KEGG   Glaciecola nitratireducens: GNIT_1913Help
Entry
GNIT_1913         CDS       T01632                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gni  Glaciecola nitratireducens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GNIT_1913
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GNIT_1913
Enzymes [BR:gni01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GNIT_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2105151..2105693
Genome map
AA seq 180 aa AA seqDB search
MKKVISLVLMMASSQIALAAECPDLLKFAKRKLNSQEVVNMCDAYKGKTVLFVNTASKCG
FTPQFEGLEALYSQYKDQGFVILGFPSNDFNQEFGDEEKTAELCELTYGVKFPMFESISV
RGESADPLYAMLAEKAGTAPKWNFYKYLMDKNGNVVESYSAFTKPDNEEFVADIKSALAL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaatttccttggtattaatgatggcgagcagccaaatagccctagccgct
gaatgccctgatttactcaaatttgcgaaaagaaaattaaattcacaagaagttgtgaat
atgtgcgatgcgtataaaggaaagacagttctcttcgttaacacggcaagcaaatgcgga
tttacaccgcaatttgaaggcctagaagcgctttatagtcaatataaagaccaaggattc
gtaattcttggttttccatcaaatgattttaaccaagaatttggcgatgaagaaaaaacg
gccgagttatgcgaactaacatacggggttaagttcccaatgttcgaatcaatttccgtt
cgtggtgagagtgcggacccactctatgcaatgcttgcagaaaaagcgggcacagcgcct
aaatggaatttttataaatatttgatggataaaaacggcaatgtagttgaatcgtacagc
gcatttacaaagcctgacaacgaagagtttgttgctgatatcaaaagcgcattagcgttg
tag

DBGET integrated database retrieval system