KEGG   Glaciecola nitratireducens: GNIT_2028Help
Entry
GNIT_2028         CDS       T01632                                 

Definition
dihydrolipoyltranssuccinate transferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gni  Glaciecola nitratireducens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GNIT_2028
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GNIT_2028
  Amino acid metabolism
   00310 Lysine degradation
    GNIT_2028
Enzymes [BR:gni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GNIT_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2246560..2248062)
Genome map
AA seq 500 aa AA seqDB search
MTIEIKVPVLPESVADATIATWHVKAGETVTRDQNLVDIETDKVVLEVVAPEDGVLSEII
HGEGDTVLGEQVIGKVEAGGSAKKESTTSEPAAEEESAASADSGKKTEIKVPVLPESVAD
ATIATWHVQPGQSVKRDQNLVDIETDKVVLEVVAPEDGSISEILAQEGETVLAEAVIANF
VAGAAAKPSKESKDSAPAAEAEQEEGDSDALSPSVRRLLAEKGVDASKVKGTGKGGRVTK
EDVEKHLKAPAKAPSTDSKEAPSIASGERTEKRVPMTRLRKTIATRLLEAKNSTAMLTTF
NEVNMKPIMDLRKQYQESFEKRHGIRLGFMSFYVKAVTEALKRFPEVNASIDGDDICYHN
YFDISIAVSTPRGLVTPILRDTDTLGMAGVEKGIKELALKGRDGKLAMSDLQGGNFTITN
GGVFGSLLSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIVDGKESV
GFLVTVKEMLEDPTRLLLDV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaataaaagttcccgtattacctgaatcagtagcagatgcaacaatcgca
acttggcatgtaaaagctggcgaaactgttaccagagaccaaaatttggttgatattgag
actgacaaagtagtattggaagtagtagcaccagaagacggcgtcttgtcagaaattatt
catggtgaaggtgataccgttttaggtgaacaagtcattggtaaagtagaagcgggaggc
tctgctaaaaaagagtcaacgacttctgagccagctgccgaggaagaatctgctgcatca
gctgattcaggaaaaaagactgagattaaagtacctgtgcttccggaatcagtcgcagat
gcaacaatagcaacttggcacgtgcagcctggacaatcagtcaagcgtgatcaaaattta
gttgatattgaaacagacaaagttgtattggaagttgttgcgccagaagatggttcaatt
tctgaaattttagctcaagaaggtgagacagtgcttgctgaggctgttattgcaaacttc
gtagcaggtgcggccgcaaagccatcgaaggaaagtaaagacagcgcgccagcagccgaa
gctgagcaagaagaaggcgactcagacgcattgagtccttccgttcgccgtttgcttgct
gaaaaaggcgttgatgctagtaaagttaaaggtactggtaaaggcggcagagtaacaaaa
gaagacgttgaaaagcatttgaaagcgccagcaaaagcgccgtcaacagattcaaaagaa
gcaccatcgattgcatctggcgagcgcactgaaaagcgtgttcctatgacgagattgcgt
aaaacaattgctactcgtttattagaggcgaaaaattcaacggcaatgttgactacgttc
aatgaagttaacatgaagcccatcatggacttgcgtaagcaataccaagagagctttgag
aagcgtcacggtattcgtttaggtttcatgtctttctacgtgaaagcggtgaccgaagcg
ttgaaacgtttcccagaagtgaatgcgtcaattgatggcgatgacatttgttatcataac
tacttcgatatctcgattgcagtttccacgccgcgtggattagtgactccaattttgcgt
gataccgatactctaggtatggcaggtgtagagaagggtattaaagaactcgcattgaaa
ggtcgcgacggcaaattagctatgtcagatctgcagggtggtaactttaccattactaac
ggtggtgtctttggctcactattgtctacgccaattatcaatccaccacagagcgcaatt
ttgggaatgcacaaaatccaagatcgtccaatggctgtgaatggtaaagtagagatttta
ccgatgatgtacctcgcgttatcttacgaccacagaattgtggacggcaaggaatcggtt
ggtttcttggtaactgtaaaagaaatgttagaagatccaacgcgtttattgcttgatgtg
taa

DBGET integrated database retrieval system