KEGG   Glaciecola nitratireducens: GNIT_2068Help
Entry
GNIT_2068         CDS       T01632                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gni  Glaciecola nitratireducens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GNIT_2068
   01230 Biosynthesis of amino acids
    GNIT_2068
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GNIT_2068
   00051 Fructose and mannose metabolism
    GNIT_2068
   00562 Inositol phosphate metabolism
    GNIT_2068
Enzymes [BR:gni01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GNIT_2068
Exosome [BR:gni04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GNIT_2068
  Exosomal proteins of bladder cancer cells
   GNIT_2068
  Exosomal proteins of melanoma cells
   GNIT_2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2296052..2296792)
Genome map
AA seq 246 aa AA seqDB search
MTNSKRRPFVAGNWKMNGSNELVDSFSLKLASNPAVDVVICPPAVYLSKFSHAEFDIGAQ
NASEFASGAHTGEISLGMISEAGCKYVILGHSERREGHAESNEIVARKVKAAIAAGLTPI
ICVGEPLEVRESGNVFAFVKAQLDAVANECGADYIKNSVIAYEPIWAIGTGKTASPEQAQ
EVHAFIRKELAALDTQAAASVRLLYGGSVNAANAKELFAKPDIDGGLIGGASLKIEDFTT
ICQAAS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattccaaaagaaggccttttgtagcaggcaattggaaaatgaatggaagcaac
gagttagttgattccttttctttaaaattggcctcaaacccggcggttgacgttgtgata
tgtcctccagctgtttatttatctaaattcagtcacgctgagtttgatataggtgcacaa
aatgcaagcgagtttgcttctggtgcgcataccggtgaaatttcgttaggtatgatttcg
gaagcaggttgtaaatacgttattctcggacactcagagcgacgtgaaggccatgcggaa
tcgaatgaaatagttgcaaggaaagtaaaagcagctatagcagcgggtctcacaccaatc
atatgtgttggtgagcccttagaagtaagagagagtggtaatgtattcgcttttgttaaa
gcgcagctagatgcagtagccaacgaatgtggcgctgattatataaagaattcagtgatt
gcctacgaaccaatatgggcaattggaacgggcaaaacagcaagcccggagcaagcgcaa
gaggtacatgcgtttattcgaaaagagttagccgcattagatactcaagcagccgcaagt
gttaggcttttgtatggtggtagtgtgaatgctgcaaacgccaaagagttgtttgcaaag
ccagatatcgatggcggcctcattggtggcgccagcttaaaaatagaagattttacaaca
atttgccaagcggcaagttag

DBGET integrated database retrieval system