KEGG   Glaciecola nitratireducens: GNIT_2144Help
Entry
GNIT_2144         CDS       T01632                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gni  Glaciecola nitratireducens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GNIT_2144 (ispE)
Enzymes [BR:gni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GNIT_2144 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2379233..2380087
Genome map
AA seq 284 aa AA seqDB search
MAEKIKWYPSPAKLNLFLHINGRYENGYHQLQSLFQLLDYGDDIGFVVNHKNEINIAEQI
SGVPEHENLVYRAAIALKPFAAEKSGCTIYINKRLPLGGGIGGGSSNAATVLLVLNQLWG
CNLDTFALADIGLALGADVPIFVHGNTAFAEGVGEVLLPTTTPEKWYLVATPNVAISTKA
IFTSVDLPRNTPKIDFKTYRFEETHNDCQTLVEKTHKEVANLLQWLVHYAPSRMTGTGAS
VFAVFDAKENADKVLHLLPECYTGFVAKGVNLSGLHIALGMQHS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtggcagagaaaataaagtggtatccaagcccagcaaagctcaacctgtttttgcacatc
aatggacgatatgaaaatggatatcatcagctgcaaagcttatttcagctattagattac
ggcgatgacattggctttgttgttaatcataagaacgaaatcaatatagctgagcaaata
tcgggtgtgcctgaacacgaaaacttagtctaccgagctgctatcgcgctgaagcccttt
gcagcagaaaaatcaggttgcacaatatacattaataaaagattacctctcggcggcggg
atcggtggcggatcttcaaacgcagccactgtattacttgtgttaaatcaactatggggc
tgcaatctcgacacgttcgccttagccgacattggattggcgctaggtgctgacgttcct
attttcgtgcacggcaacaccgcattcgcagaaggcgtaggtgaagtattattaccaacc
acgacacctgaaaaatggtatttggtagcgacgcccaatgtggcaatatcaaccaaagct
atttttacgtctgtagatttaccgcgaaataccccaaagattgatttcaaaacgtaccgt
tttgaagaaactcacaacgattgccaaactttagtggagaaaacgcataaggaagttgca
aatttattacagtggttggtacactacgcaccgtcccggatgactggaacaggtgcaagt
gtttttgcagttttcgatgcgaaagaaaacgcagacaaggttctccacttgctacccgaa
tgttacactggttttgttgctaaaggcgttaacctttcaggtttgcatatcgccttgggt
atgcaacacagctaa

DBGET integrated database retrieval system