KEGG   Glaciecola nitratireducens: GNIT_2184Help
Entry
GNIT_2184         CDS       T01632                                 

Gene name
bdh
Definition
3-hydroxybutyryl-CoA dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
gni  Glaciecola nitratireducens
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    GNIT_2184 (bdh)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    GNIT_2184 (bdh)
Enzymes [BR:gni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     GNIT_2184 (bdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2423844..2424623
Genome map
AA seq 259 aa AA seqDB search
MSGTAKTLNVFVTGGASGIGYGIGEYLAKQGHHIVIADINEEAAKQAAKKLNDLGLSAQS
VQINVCDAQQVAALPAALSNTPIDILINNAGIQHVSKLEDFPAEKWQMLINVMLVGPALL
TQAFLPHMRAQNFGRIINVGSIHSVIASPFKSAYVAAKHGLLGFAKTMALETGDVDVTIN
TLCPAYVKTPLVEQQIAAQAKENNMSEEDVINKIMLEPMPKKAFIEIDELAQTANFLIGS
AAKNITGQTLILDGGWTAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtacagccaaaactttaaacgtatttgtaacaggtggtgcaagtggcattggc
tacggtatcggtgaatatctagcaaagcaaggccatcacattgttattgcagacatcaat
gaagaagcggctaagcaagcggctaaaaagctcaatgatttagggctctctgcccagtcg
gtgcaaattaatgtgtgtgatgcacagcaagtggctgcattgcccgcagcactcagcaac
actccaattgatatccttatcaacaatgcgggcattcaacatgtcagcaagctcgaagat
ttcccagctgaaaagtggcaaatgctaattaacgttatgcttgttggacccgcattatta
acccaggcatttcttccgcacatgcgcgcccaaaattttggtcgaattattaacgtgggc
tctatccattcagttattgcatcaccatttaaatccgcctatgtagcggcaaagcacgga
cttctgggctttgcaaaaaccatggctttagagacaggtgatgtggatgtaacgattaat
acgctctgccctgcttacgttaaaacacctttggttgagcaacaaattgcagcccaagcc
aaagaaaataatatgtctgaagaggacgtaataaacaaaataatgctagagcccatgcct
aaaaaagccttcatcgaaatagatgagttagcacaaacagcaaactttttaattggcagc
gcagcaaagaacattacaggtcaaacgctaatattagatggcggctggactgcaaggtaa

DBGET integrated database retrieval system