KEGG   Glaciecola nitratireducens: GNIT_2234Help
Entry
GNIT_2234         CDS       T01632                                 

Definition
asparagine synthetase B (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gni  Glaciecola nitratireducens
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GNIT_2234
Enzymes [BR:gni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     GNIT_2234
Peptidases [BR:gni01002]
 Cysteine Peptidases
  Family C44
   GNIT_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2476817..2478493
Genome map
AA seq 558 aa AA seqDB search
MCGIFGILDIKTDVSELRTQALELSKLLRHRGPDWSGIWHNDNTILCHERLAIVDVDTGA
QPLISGNGNQVLAVNGEIYNHKDLESKLATPYNFATKSDCEVILPLYQQEGVNFIDKLEG
MFAFVLYDQESNTYLIARDHIGIIPLYTGFDEFGNFYVASEMKALVPVCKTVQEFPPGHY
LSSTDGKLVKYYQRDWMSYENVKDNETNLDDLKAAFEKAVKSHLMSDVPYAVLLSGGLDS
SLVSAVAARYVAKRVEDEDKSDAWWPRLHSFAVGLEGAPDLIAAKKVADMIGTVHHEIHF
TIQEGLDAIRDVIYHLETFDTTTIRAATPMYLMTRKIKAMGIKMVLSGEGADEIFGGYLY
FHKAPNAKELHEETVRKLDRLHMFDCARANKSTSAWGVEARVPFLDKNFLDVAMRLNPKD
KMCIDGRMEKWILRKAFDDETYLPAEVLWRQKEQFGDGVGYSWIDSIREFVAQEVSDQQM
ATAEFRFPINTPDTKEGYYYRTIFEDYFPQESAAKCVPGGKSIACSTVEALEWDASFKES
ADPSGRSMKSIHSGEFKA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttcggtatccttgatatcaaaactgatgtgtcagagttgcgcacgcaa
gcactcgaattatcaaaactattacgtcatcgtggcccagactggtcaggcatttggcac
aatgataatacaattttatgtcatgaaagactggcaattgttgacgtcgacacaggcgct
cagccattaatcagtggcaatggtaatcaggtattagctgttaatggcgaaatttataat
cataaagatctggaatcaaaactagcgactccttacaactttgcaacaaaatcagattgc
gaagtcattcttccgctatatcaacaagaaggcgttaatttcatagacaaactggaaggt
atgtttgcctttgttctttacgaccaagaaagcaatacttatttaattgcaagagaccac
atcggcattattccgttatataccggctttgatgaattcggtaacttctatgttgcctct
gaaatgaaagcactggtccctgtttgcaaaacagtacaagaattcccaccaggacattat
ctaagcagcactgatggcaagctagtcaaatactatcagcgcgattggatgtcttacgag
aacgtaaaagacaacgaaaccaatttggacgacttgaaagctgcatttgaaaaagcggta
aaatcacatcttatgtcggatgttccttacgccgtgttgctctctggcggtctggattca
tcattagtatctgcagtagccgcaagatacgttgctaagcgcgtggaagacgaagataaa
agcgatgcttggtggcctcgcttgcactcattcgccgttggactcgaaggcgcaccagac
ttaattgcggcaaagaaagtcgcagatatgattggcactgtacatcatgaaattcacttt
accattcaagaaggtttagatgcgatccgtgacgttatttaccacttagaaacattcgat
actacgacgatccgtgcagcaaccccaatgtatttaatgaccagaaaaatcaaagcaatg
ggcattaaaatggtcttatctggcgaaggcgcagatgaaatatttggtggatatttatat
ttccataaagcaccaaatgcaaaagagctgcatgaagaaacggtgcgtaagctcgaccgt
ctgcacatgtttgattgcgctcgcgctaacaagtcaacgtctgcttggggcgtcgaagct
cgtgtacctttcctcgataaaaacttcttggatgttgctatgcgcttaaatccaaaagac
aagatgtgtattgatggacgcatggaaaagtggatattaagaaaagcatttgatgacgaa
acttatctccctgccgaagtgttatggcgtcaaaaagaacagtttggagatggtgttggc
tattcttggattgactcgattcgtgagtttgttgcgcaagaagtctctgatcaacaaatg
gcaactgcagagttccgctttccaattaatacaccggacaccaaagaaggctactattac
agaaccatttttgaagattacttccctcaagagagtgctgctaagtgtgttccaggtggt
aagtcaatcgcttgtagcaccgtcgaagcacttgagtgggatgccagcttcaaagagtct
gcagatccctctggtcgttcaatgaagtctatccacagcggtgaatttaaagcataa

DBGET integrated database retrieval system