KEGG   Glaciecola nitratireducens: GNIT_2451Help
Entry
GNIT_2451         CDS       T01632                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00900  Terpenoid backbone biosynthesis
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01130  Biosynthesis of antibiotics
Module
gni_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GNIT_2451 (dxr)
Enzymes [BR:gni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     GNIT_2451 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NmrA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEP30548
UniProt: G4QI15
Position
complement(2704285..2705496)
Genome map
AA seq 403 aa AA seqDB search
MDGLGNYVDIMRTITVLGATGSIGQNTIDVISRHPDKFRVFAITGHANLKALVQLAMQCS
PRYIVLSDPNTYTTFISLLKAENCHSEVLVGAKALEDVCSAPEVDTVMSAIVGAAGLLPT
LAAVRAGKRVLLANKESLVMSGELFMNAVREYKAELLPIDSEHNAIFQCLPHDFEYGNLD
KSGIAKILLTGSGGPFRTLPSESFDSITPDQACAHPTWTMGRKISVDSASMMNKGLEFIE
AKWLFGLHENDIEVVLHPQSTIHSMVQYTDGSVIAQLGNPDMRTPIAYGLSFPERINSGV
DAVDFSSLCDFSFSKPDEARYPNLYLAIEACKQGQAATTAINAANEVAVDAFLKGQIKFT
DIAKVNQQALQKTDLIELTSIVQVLEHDEEARSLARELVRKLN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggatggcttaggcaactatgttgatatcatgagaaccatcactgtcctaggggcaacc
ggctctattggtcaaaatacaatagacgttatttctcggcatccggacaaatttcgggta
tttgctatcaccggccatgctaatttaaaggcactggttcaacttgctatgcagtgctct
ccacgctatatcgtgctgtctgatcccaatacctacactacttttatttccttgttgaaa
gccgagaactgtcactcagaagtgctggtcggcgcaaaggcattagaagatgtttgttcg
gcgccagaagtcgacactgttatgtcagcgattgttggagcggctggtttattgccgact
ttggcagcagttcgtgctggtaaacgcgtgctcttggcgaacaaagagtcactcgttatg
tctggtgaattattcatgaatgcagtgcgtgaatataaagcagaattattgcctatagac
agcgaacacaatgcgatatttcaatgtttgccgcatgattttgaatacggaaatttagac
aaatcaggcattgcaaaaatcctgttgacgggctcgggaggtccttttagaactctaccg
agtgagtcttttgatagtattactcctgatcaagcttgcgctcatcctacctggacaatg
ggaagaaaaatctctgttgattcagcctctatgatgaataaaggtctagagtttatcgaa
gcaaaatggctattcggcctgcatgaaaatgacatcgaagttgtcctgcatccacaaagt
actattcattccatggtgcaatatacggatggttcagttattgctcagcttggtaatcct
gatatgcgcacgcctattgcttatggccttagttttcctgaacgaattaattctggtgtc
gacgcggtcgatttttctagcttatgcgattttagcttttcaaagccggatgaagcccgc
taccctaatttgtatctagcaatcgaggcatgcaaacaaggacaagccgcgaccactgcc
attaatgcggcaaatgaagtagcggttgacgcatttttaaaaggacagattaagtttact
gacattgcaaaggtgaatcagcaggcgctgcaaaaaaccgatttaattgaactgacatct
attgtacaagtcttagaacatgacgaagaagccagaagcttagcgcgagaattagtgagg
aagttaaattag

DBGET integrated database retrieval system