KEGG   Glaciecola nitratireducens: GNIT_2636Help
Entry
GNIT_2636         CDS       T01632                                 

Gene name
dgcB
Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
gni  Glaciecola nitratireducens
Brite
Enzymes [BR:gni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     GNIT_2636 (dgcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2920944..2921960)
Genome map
AA seq 338 aa AA seqDB search
MAKTDIEKSFQTLKSTIPLLLKYNIPAIPTNYALWYTYVSNDSPQLNQDIDENLQKGYPL
SVAKTKELYRNYLSEKQEVDAWQLRQSMEAMLLEVSQSMKDTKSDTTEFKSLMDANLDNL
SKVEKEGLSVTEVMALVRKMVHELQAIRQKTISFSGSLVKAEKEIESLKLKLQESQHEAL
YDALTGLCNRRYFDSEIESKIGIDKMSLMLIDIDHFKIINDTHGHLMGDLVLKAVAKKLQ
SGCREDAQVFRYGGEEFVILMPGADLQKARHIADVMRRSIEKIAVKDRRTGNVLGDVTVS
IGVAQRTKGEQPHDLVERADKLLYKAKTLGRNRVMPIS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaccgacatagaaaaatcatttcaaactctcaaaagcactatacctttgttg
ttgaaatataatattcccgctatccccaccaattatgccctctggtatacgtatgtttct
aacgattctccacagttaaatcaggacattgatgaaaacctgcaaaaaggttatccgctt
tccgtggcgaaaacaaaagagttatatcgtaattatttatctgaaaagcaggaagtcgat
gcttggcaattgcgccaaagcatggaagcaatgttattagaagtgtcgcaatcgatgaaa
gacacaaaatctgacacgactgaatttaaatccttaatggacgctaatctcgataacttg
tcgaaagtagaaaaagaaggcttgtcagttaccgaggttatggcattggtacgcaagatg
gtgcatgaattacaagccattaggcaaaaaactattagttttagtggttcattagtcaaa
gctgaaaaagagatagagtcgctaaaattaaagctgcaggaaagtcaacacgaagcctta
tacgatgctcttacaggcttatgcaaccgacgttattttgattcagaaatcgagagcaaa
ataggtatcgataagatgtcattaatgcttatagacattgatcattttaaaatcattaat
gatacccatgggcatttaatgggagacttagtactgaaagcggtcgctaaaaaattacaa
tccggttgccgtgaagatgcacaagtcttccgctacggcggcgaagaatttgttatattg
atgccaggtgcagacttacaaaaagcaaggcatatcgcagatgtaatgcgacgctcaatt
gagaaaattgcggtaaaagataggcgcactggcaacgtgctgggtgacgtaactgtatca
attggcgttgcccaacgaaccaaaggtgaacagccccatgacttggtggaacgcgcagac
aaactgctttataaagcaaaaacgcttggacgtaaccgagtaatgccaatcagttaa

DBGET integrated database retrieval system