KEGG   Glaciecola nitratireducens: GNIT_2660Help
Entry
GNIT_2660         CDS       T01632                                 

Gene name
rbsK
Definition
sugar kinase, ribokinase family protein (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gni  Glaciecola nitratireducens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GNIT_2660 (rbsK)
Enzymes [BR:gni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GNIT_2660 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2944802..2945695
Genome map
AA seq 297 aa AA seqDB search
MAVFNFGSINIDHVYSVPHFVQPGETLSSSSYQSILGGKGANQSVALAKANNNVFHVGAI
GSSDSGFIEQMKEAGVNCEFIREMSDVASGHAIIQVTPDAENNIILFGGANQCISDDHIA
SALATAKPNDWVLLQNETNAIDKIITEAHKRQLHIAFNPAPMTESVKQLPLDKLTLLVVN
EVEAEQLTGENDVEAIKRSLKSNYPNTKVLLTLGKAGVWFFEADNEEFCAAFKVKAVDTT
AAGDTFIGFFLAAYQANKSIAEALKYACAASALAVMKAGAAPSIPSVDEVIAFLQTQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttttaactttgggtcaatcaatattgaccacgtgtattctgttccccacttc
gtacaaccaggcgaaactctctcatcaagcagttaccaatcaatcttgggcggcaagggc
gcgaaccaatcggttgcattggctaaagcaaataacaacgtttttcacgttggggctatc
ggcagctcggacagcggcttcatcgaacaaatgaaagaagcgggtgtaaactgtgagttt
attcgcgaaatgagtgatgttgcctctggccatgccattattcaagttacccctgatgcg
gaaaacaacattattttattcggtggtgctaaccaatgtattagcgatgaccatatcgct
agcgcattagccactgccaagccaaacgattgggtgttactgcaaaacgaaaccaacgcc
attgataaaatcatcacagaagcgcacaagcgacagttgcacattgcctttaatccagcg
ccaatgactgaatcggttaaacaactaccattggacaaactaacgctgctagtagtaaac
gaggttgaagccgaacaactcactggtgaaaatgacgtcgaagcaattaaacgctcacta
aaatcaaattatccaaacaccaaggtcctgctcacattaggcaaagctggcgtgtggttc
tttgaagccgataacgaagaattctgtgcggcattcaaagtcaaagccgtcgataccaca
gcagcgggtgacaccttcattggcttttttctagctgcctatcaagcaaacaaaagcatc
gctgaagccttaaaatatgcctgtgcggcgtcggcattagcagtaatgaaagcaggcgct
gcgccctccattccaagcgttgacgaagtcattgcttttttacaaacacaatag

DBGET integrated database retrieval system