KEGG   Glaciecola nitratireducens: GNIT_2672Help
Entry
GNIT_2672         CDS       T01632                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gni  Glaciecola nitratireducens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GNIT_2672
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GNIT_2672
   00020 Citrate cycle (TCA cycle)
    GNIT_2672
   00620 Pyruvate metabolism
    GNIT_2672
Enzymes [BR:gni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GNIT_2672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2955644..2957422)
Genome map
AA seq 592 aa AA seqDB search
MANLIDIIVPDVGEDEVEVIEILVAEGDSVDVEASIVTVESDKASMDIPCTEAGTIKSLK
VKVGDKIKQGDVLGQMESGAAESNDDESKSEKTESDDSKKEEAKSDDSKKENAKSEDSKS
ASSKSEESKAAKSKSSGSKTIEVTVPDIGDATDVEIIELLVAEGDTVAAEDGLITLETDK
ATMDVPAPEGGKIVSLSVKVGDKVSKGSLVLMLEVEDDEADSSEDDTDSSTEDSSDAAAS
KSDNSSSESSSKSSDTSSAPAQTQKAPPVPHHPSAGGKVSTGKVHASPSVRRLAREFGVD
LTQVEGSGRKNRVQKEDVQSFVKYELSRPKMNPGSSAGSGNTGGGLQVLAQPKVDFAKFG
EVEEVPLTRIQKLSGPNLHRNWVTIPHVTQFDEADITELEEFRKEQNAIAEKRKLGVKIT
PLVFMMKAVADAMKEYPAFNSSLSESGEALVMKKYFHIGIAVDTPGGLVVPVVRDVDKKG
IMEISKELMEISVKARDGKLKSADMQGSCFTISSLGGIGGTAFTPIVNAPDVAILGVSKS
EIKPKWNGKDFEPRLMLPLSLSYDHRVIDGAMAARFAVHVSGALSDLRRILL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatttaatagacattattgttcctgatgttggcgaagatgaagttgaagttatt
gagatcttagttgccgaaggcgattcagttgatgtagaagcatcaattgtgacggttgaa
agtgacaaagccagtatggatattccgtgcactgaagccggcacgattaagtcacttaag
gtaaaagtaggtgacaaaattaagcaaggcgatgtgttaggtcaaatggagtctggcgct
gcggaatcaaacgatgatgaaagtaaatctgaaaaaactgaatcggatgatagtaagaaa
gaagaagctaaatcggatgatagtaaaaaagaaaatgctaaatcagaggattccaagtca
gcatcttcaaaatcagaagaatctaaagcagctaaatctaaatcaagtggcagcaaaaca
attgaagtgacggtgccagatatcggcgatgccactgacgtagaaattatagaactttta
gttgccgagggtgacacggttgcagcagaagacgggctaattacgcttgaaactgataag
gcaacaatggacgtgccagcacctgaaggtggtaaaattgttagcttatctgtaaaagtt
ggcgataaagtatccaaaggctcactggtattgatgttagaagttgaagatgatgaagca
gattcaagtgaagacgatactgattcgagcactgaagattcaagtgatgcggctgccagc
aagtctgataatagttcttctgaatcatcttcaaaatcgtcagatacaagcagtgcacca
gcgcaaacacaaaaggcaccgccagtaccccatcatccgtcagcgggtggtaaggtaagc
acaggcaaagtacatgcatcgccttcggttcgtcgtttagcgcgtgagtttggcgttgac
cttacacaggttgaaggctcaggacgtaaaaaccgtgttcaaaaagaagatgtgcagtcg
ttcgttaaatatgaactttcacgtccgaagatgaatccaggcagttcagcaggttctggc
aatacaggcggcggtttacaagtgttggcgcagcctaaagtcgattttgccaagtttggt
gaagttgaagaggtgccattaacgcgcattcaaaaactttcgggtcctaatctacatcga
aattgggtcactattccgcacgttactcagtttgacgaagcagatattaccgaactagaa
gagttccgaaaggaacaaaacgcgatcgctgaaaagcgcaagcttggcgtgaaaatcaca
ccgctcgtctttatgatgaaagccgttgccgatgcaatgaaagaatatccagcattcaac
agtagtttgtctgaatctggcgaagctttagtaatgaaaaaatatttccatatcggcatt
gctgtagatacccctgggggcttagtggttccagttgttcgtgatgttgataaaaaaggc
atcatggaaatttctaaagagttaatggaaatcagtgttaaggccagagacggcaaatta
aaatcggcagatatgcagggcagttgtttcactatctctagcttgggcggtattggcggc
acggcatttacgccaattgtaaatgcgccggacgtggccattttgggcgtttctaaatca
gagataaaaccaaagtggaatggtaaagactttgagcctcgtttaatgttgccgttgtcg
ttgtcatatgaccatcgcgtgattgatggtgcaatggccgcgcgctttgcggttcacgta
agtggtgcattgtcagacttaagacgtattttgttataa

DBGET integrated database retrieval system