KEGG   Glaciecola nitratireducens: GNIT_2755Help
Entry
GNIT_2755         CDS       T01632                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00260  Glycine, serine and threonine metabolism
gni00750  Vitamin B6 metabolism
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01120  Microbial metabolism in diverse environments
gni01230  Biosynthesis of amino acids
Module
gni_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GNIT_2755
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GNIT_2755
Enzymes [BR:gni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GNIT_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEP30852
UniProt: G4QID8
Position
complement(3050128..3051411)
Genome map
AA seq 427 aa AA seqDB search
MNLVNLKDASDKVSFAEAVKKGLGKNQGLYFPQEITPFENINDVLALPFVERSIRILKQL
IGDELPDELLSKIVTTAFQFGAPLVKVTENIYSLELFHGPTLAFKDFGGRFMAQCLDNIS
AGQPITILTATSGDTGAAVAHAFHGIDNIQVVILFPKGKISKLQEKLFTTLGDNIHTVAI
ESDFDACQQLVKAAFDDPEVRDGLHLNSANSINISRLFAQVCYYFEAIAQLPKEQQDKAV
FSVPSGNFGNLTAGMIAKSLGLPIKRFIAATNANDTVPRYLQTGEWAPKPTVATISNAMD
VSQPNNWPRIEALIEQGYIDKDSLIGEAIDEEYTQVAMRQLASLGYVSEPHAAIGYRSLS
RSLTGDEVGIFLGTAHPAKFRETVENVLGQPISLPQPLADCVGKPDFSVEVENSYEALKS
HLFSILK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttagtaaatttaaaagatgcgagtgataaagtaagttttgccgaagcggtaaag
aaaggcttgggtaaaaaccagggtttatattttcctcaagagattacgccctttgagaat
attaacgacgtgttggcgttgccttttgtcgaaagaagtattcgaatattaaagcaactg
attggtgacgagttacctgatgagttgttaagtaagattgttaccactgcatttcaattt
ggcgcacctttggtaaaggtcaccgaaaatatttatagcttggagctttttcacggtcca
acattggcatttaaagactttggcgggcgcttcatggcgcagtgcttagataacattagt
gcaggtcagccaatcactattttaactgcaacgtcgggtgacaccggtgctgcagttgct
catgcttttcatggcattgacaacattcaagttgttattttgtttcctaaggggaaaatt
agcaaactacaagagaagctatttactaccttaggtgacaatattcataccgttgcaatc
gaaagtgattttgatgcttgccagcagctagttaaagcggcatttgatgatcctgaagta
cgcgatggactgcacttaaactcagctaactcgattaatatcagccgtttgttcgcacaa
gtttgctattattttgaagcgattgcacaattaccaaaagaacaacaagacaaggctgtt
ttttccgtaccaagcggcaactttggtaatttaacagcaggtatgattgctaagtcgctg
ggactgcctattaagcgctttattgcggcaactaatgcaaatgacactgtacctcgttat
ttgcaaacaggtgaatgggcacccaagcctaccgttgctacgatttcgaatgccatggac
gttagccaaccaaataattggcctcgaatcgaagcattaattgagcagggatatatcgat
aaagatagcctgattggtgaggcgattgacgaagagtatactcaagttgcgatgcgtcaa
ctcgcaagcttaggttatgtttcagaaccacatgcggccattggctatcgttcattatcg
cggtctttaactggcgatgaagtgggtattttcttaggaactgcacacccagctaaattt
agagaaaccgttgaaaacgtgctaggtcagcctatcagcttgccacagccactggctgat
tgtgtcggtaagccagatttctctgtggaagttgagaacagctacgaagcgctaaagtcg
catttattttcgatcttgaaataa

DBGET integrated database retrieval system