KEGG   Glaciecola nitratireducens: GNIT_2869Help
Entry
GNIT_2869         CDS       T01632                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00010  Glycolysis / Gluconeogenesis
gni00620  Pyruvate metabolism
gni00640  Propanoate metabolism
gni00680  Methane metabolism
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01120  Microbial metabolism in diverse environments
gni01130  Biosynthesis of antibiotics
gni01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GNIT_2869
   00620 Pyruvate metabolism
    GNIT_2869
   00640 Propanoate metabolism
    GNIT_2869
  Energy metabolism
   00680 Methane metabolism
    GNIT_2869
Enzymes [BR:gni01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GNIT_2869
Lipid biosynthesis proteins [BR:gni01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GNIT_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEP30966
UniProt: G4QML4
Position
complement(3177449..3179200)
Genome map
AA seq 583 aa AA seqDB search
MGYAPIKKDVNKTHRPANMLSYQHSYDNFKWHKAKAMIRGYKGGINMGYEAADRHVDDGF
GSQEALIFLDQKKTRKALSYTQLQQMSNRFANLLKSVNVEKGDLLCSLTDRTPILYAAVI
GCLKSAVVFSPLFSAFGSEPIKARMTIGGAVALLTSGKLYKKKIAAWRNECPSLKTVLLY
ECEGECPSDCIDLDQTLETQSDLFNIYATDPEDKALIHFTSGTTGTPKAVVHVHDAVIYH
KYSGYYALDIHPQDVYWCTADPGWVTGISYGVISPLCNRATLIVDNAEYDANRWYSILEQ
EHVNIWYTAPTAIRMLMKAGNELCEQYDLSALRFLASVGEPLNPEAVVWSQKHLGNVFHD
NWWQTETGGIMLANFMSEDVRPGSMGRPLPGIQAGIVRVDEQGHLVELSKPNETGELAFK
KGWPSMFRDYLHESKRYQACFNGDWYLSGDLAYKDQDGYFWFVGRRSDLIKSSGHLIGPF
EIESVLLEHPAVAEAGVVGVPDAIAGELVKAFIALKDGYEDDPALRKSIMAHARKKLGSA
LAPREISVKQNLPKTRSGKIMRRLLKARELGLPEGDISTLESD
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgggttacgccccaattaaaaaagacgtaaataaaacgcatagaccagctaatatgctc
agttatcagcacagctatgacaattttaaatggcataaagccaaagcaatgattagagga
tataaaggcggcatcaatatgggctatgaagccgcagaccgacatgttgacgacggattt
ggaagtcaagaagcgctaatcttcttagaccaaaaaaaaacgcgtaaagcactttcatat
acccagctgcagcaaatgagcaatcgtttcgcaaaccttttgaaaagtgtgaacgttgag
aaaggggatttactttgtagcttgaccgatcgtactcctattttatatgccgcggttatc
ggttgtttaaaatcggcagttgtatttagtcctttgttttcagcctttggttcagaaccg
ataaaagccagaatgaccataggtggagctgtcgcattgctcacgagtggcaagctttat
aagaagaaaatagctgcgtggcgcaacgaatgcccgagtttaaaaacggtattactgtat
gaatgcgagggagaatgcccaagtgactgcatcgacttagaccaaactttagaaacacaa
agcgatctattcaatatatacgcaaccgaccctgaagataaggcactaatacattttact
agcggtaccactgggacaccaaaagccgttgtgcatgtacatgacgctgtcatatatcac
aagtattcagggtattacgcgttagatatccaccctcaagatgtttattggtgcaccgcc
gaccccggctgggttaccggaatatcttatggggtaatttcgcccctatgcaaccgggca
acattaatcgttgataatgctgaatatgacgccaatcgttggtacagcatattagagcaa
gaacatgtcaatatttggtataccgcaccaacagccattcgcatgttaatgaaagcgggc
aacgagctgtgtgaacaatatgacctatctgctttacgcttcttggcgagcgtcggagaa
ccgcttaatcctgaagctgtggtgtggagtcagaagcacctaggtaacgtattccatgac
aactggtggcaaactgaaaccggcggcatcatgcttgcaaattttatgagtgaagatgtg
aggccagggtcgatgggacggccgttgcctggcatccaagctggtattgttagagtagat
gaacaggggcatttggttgaactcagcaaacctaacgaaactggggagttagcattcaaa
aaaggttggccctctatgtttcgcgattacctgcatgaaagtaaacgctatcaagcgtgt
tttaacggcgattggtatctaagtggtgacttagcatacaaagaccaagatggttatttt
tggttcgtgggtcgtcgttcagatttgattaaatcttcggggcatttaatcggcccgttc
gaaatagaaagtgttttgcttgaacaccctgcggtggcagaggctggcgtagttggtgtt
cctgatgccattgcaggtgaattagtaaaagcattcattgctctcaaagacggctatgaa
gatgatcccgctttacgtaaaagcatcatggctcatgcccgcaaaaaattaggctccgca
ctcgctcccagagagattagcgtgaaacaaaacctgccaaaaacgcgcagcggaaaaata
atgcgcagattgttaaaggcccgagagctcggtcttcctgagggagatatttctacacta
gaaagtgactaa

DBGET integrated database retrieval system