KEGG   Glaciecola nitratireducens: GNIT_2932Help
Entry
GNIT_2932         CDS       T01632                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00071  Fatty acid degradation
gni00280  Valine, leucine and isoleucine degradation
gni00281  Geraniol degradation
gni00310  Lysine degradation
gni00362  Benzoate degradation
gni00380  Tryptophan metabolism
gni00410  beta-Alanine metabolism
gni00640  Propanoate metabolism
gni00650  Butanoate metabolism
gni00903  Limonene and pinene degradation
gni00930  Caprolactam degradation
gni01040  Biosynthesis of unsaturated fatty acids
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01120  Microbial metabolism in diverse environments
gni01130  Biosynthesis of antibiotics
gni01200  Carbon metabolism
gni01212  Fatty acid metabolism
Module
gni_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GNIT_2932 (fadB)
   00650 Butanoate metabolism
    GNIT_2932 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    GNIT_2932 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    GNIT_2932 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GNIT_2932 (fadB)
   00310 Lysine degradation
    GNIT_2932 (fadB)
   00380 Tryptophan metabolism
    GNIT_2932 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GNIT_2932 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GNIT_2932 (fadB)
   00281 Geraniol degradation
    GNIT_2932 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GNIT_2932 (fadB)
   00930 Caprolactam degradation
    GNIT_2932 (fadB)
Enzymes [BR:gni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GNIT_2932 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GNIT_2932 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     GNIT_2932 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     GNIT_2932 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF4078 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AEP31029
UniProt: G4QMU6
Position
3249736..3251895
Genome map
AA seq 719 aa AA seqDB search
MIFEGKSLSVALTDDSIAELVFDAQGSVNKFDKQTVEELDQATAAIAASSDVKGVLVRSA
KSTFIVGADITEFTALFDMDPADILTWVGKTSQVFDHFEDLAVPTVVAVNGFALGGGCEM
ALAGDIRVVDTTARIGLPEVKLGLMPGFGGTVRLPRIIGADNALEWMTTGRDRDGAQALK
EGAVDAVVAPENLHEAARSMLKDAIAGKLDWQARRAEKKAPLMLNENEAMMSFSTAAAMV
AAQAGKHYPAPHKMVETVSKAAGLDRDGALKIENEGFVALAKTDACKAQVGIFLADQLVK
AKGKKVAKGATKEVKQHAVLGAGIMGGGIAYQGAVKGIPTVMKDINQAALELGLKEASSI
LEKGMQRGKVDARKMASTLNNIIPTLDQNAIADADLIIEAVVENPKIKAAVLADTEKTVA
EDAIICSNTSTISINQLAKSLKHPERFCGMHFFNPVHKMPLVEIIRGEKTSEATISAVVA
ATLKMGKTPIVVNDCPGFLVNRVLFPYFAGFSQLLIDGADFTAVDKVMEKIFGWPMGPAF
LLDVVGMDTADHASSVMSDGIPERMQKIDNDPVTLLYKAGRYGQKNGKGFYDFSKDKRGR
PTKTASPQAYALFEGHVAETKTFDKEEIIARVMIPMANEAIRCLEEGIVASAAEADMALL
FGLGFPPFRGGIFRYIETMGLANFVALADKYASLGPIYQISDGVREMAASGKSYFSQSA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgaaggcaagagtctttcagtagcactgacagacgactcaatcgctgaactt
gtgtttgacgcacaaggttcagtcaacaaattcgacaaacaaacagtcgaagagctcgac
caagctacagctgctatagctgcctcaagtgacgtaaaaggcgtactcgtacggtctgct
aaaagcacgttcattgtaggtgcagatattactgaattcactgcattatttgatatggac
ccagcagatatattaacttgggtaggaaaaacctctcaggtatttgatcatttcgaagac
ctcgcggttccaaccgtcgtggctgtaaatggttttgcgctaggcggcggctgcgaaatg
gccttggctggcgatatacgtgtggtcgacaccacagccagaattggattacccgaagtc
aaacttggcttaatgcctggtttcggaggaaccgttcgtcttccgcgcattatcggcgct
gataacgctctcgaatggatgaccacaggccgcgaccgcgacggcgctcaagcattgaaa
gaaggcgctgttgacgcagttgttgcgccagagaacctgcatgaagctgcacgcagcatg
ttgaaagacgcaatcgccggtaaactagattggcaagcacgcagagcagaaaagaaagca
ccattgatgctaaatgaaaacgaagcaatgatgagcttttcaactgcagccgctatggtt
gctgcgcaagccggtaaacattatccagcaccgcataaaatggtagaaaccgtcagcaag
gctgcaggtcttgacagagatggagccctaaagattgaaaacgaaggctttgtagctctc
gcgaaaaccgatgcatgtaaggcacaagtcggtatcttccttgctgatcaactagttaaa
gcaaaaggtaaaaaagttgctaaaggcgcaaccaaagaagttaagcaacacgctgtttta
ggtgcaggcatcatgggtggcggtatcgcttaccaaggcgctgttaaaggcattccaacg
gtaatgaaagatattaatcaagctgcattagagctaggcttaaaggaagcgtcaagcatt
cttgagaaaggcatgcagcgcggtaaagttgatgcgagaaaaatggcatcaacattaaac
aacattattccaacgcttgaccaaaacgcaattgcggatgccgatcttattattgaagcg
gttgttgaaaacccgaaaattaaagcagctgttttagctgacacagaaaagacagtggct
gaagacgcgattatttgttcaaacacgtctacaatttctattaaccagttagcaaaaagc
ctaaaacacccagagcgtttctgcggcatgcattttttcaatccagtacataaaatgcca
ttggttgagattattcgcggtgaaaaaacgtcagaagcaaccatcagtgcagtcgttgct
gcaaccttgaaaatgggtaaaacacctattgttgttaacgactgtcctggatttttggtt
aaccgcgttttattcccatacttcgcaggcttcagccagttattgattgatggtgctgat
tttactgctgttgataaagttatggaaaagatatttggatggcctatgggcccagcattt
ttgcttgatgttgtaggcatggacacagcagatcacgcttctagtgttatgtctgatggc
attccagagcgcatgcaaaaaattgacaacgacccggttacgctgctttacaaagctggc
cgatatggtcagaaaaatggcaaaggtttctacgacttctcgaaagacaagcgtggacgc
ccaaccaaaacagcatcaccgcaggcgtatgctttgtttgaaggtcatgttgctgaaaca
aaaacattcgacaaagaagagattattgctcgcgtaatgatcccaatggcaaatgaggct
attcgttgtttggaagaaggcatagttgcaagtgcagcagaagctgatatggcattgttg
ttcggtttaggtttccctcctttccgcggcggtatcttccgttacattgaaacgatggga
ctcgcaaattttgtggcattagccgacaaatacgccagccttggtccaatatatcaaatt
tcagatggcgtgcgcgagatggccgcttctggaaaatcttacttttcacaatcagcctaa

DBGET integrated database retrieval system